DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and mos

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_991143.1 Gene:mos / 795517 ZFINID:ZDB-GENE-040428-3 Length:329 Species:Danio rerio


Alignment Length:282 Identity:81/282 - (28%)
Similarity:133/282 - (47%) Gaps:56/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIREGC-EDKKIEREIY--QLTKA--SHVNIV 67
            :.:.|:|..|.||:|.:|:|:|..:....:|:|:::  | ::|...|:.:  :|..|  .|.|||
Zfish    55 IHWRELQALEPIGSGGFGTVFRGTYFGETVAVKKVK--CVKNKLASRQSFWAELNAAHLHHQNIV 117

  Fly    68 ELYG----TSRH----EGCALLLMEFVDGGSLSSFLHAKSK--PSYSHAHAFNWAHQIAQGIAYL 122
            .:..    |..|    :....::|||....:|...::..:.  |.   .....::..||:.:.:|
Zfish   118 RVLAATTCTPAHLNTKDNIGTIVMEFAGNINLQKLIYGLTDLLPV---EKCIKYSIDIARALQHL 179

  Fly   123 HGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFG----------TVVDLSQSISCNAGTCRYKAPE 177
            |.   ..|:|.|:||.|.||.|:|: .||.|||          ||..:::.    .||..::|||
Zfish   180 HA---HGVVHLDLKPANVLLSEQGV-CKIADFGCSFKISSTSDTVTHMNEI----GGTFTHRAPE 236

  Fly   178 VLQGNKPDEKCDVYSWAITFWEILSRKEPFE---QYNTLFELYMAINEGERPDLS-------CIM 232
            :|:|.:...:.||||:.||.|::|:|:.|:|   ||    .||..:....||..|       .|.
Zfish   237 LLKGEEVSPRVDVYSFGITLWQLLTREPPYEGDRQY----ILYAVVGYNLRPLTSRNVFTQFFIG 297

  Fly   233 SGCPADIVALLYASWDPDISKR 254
            ..|.    .|:...||.|.|.|
Zfish   298 QNCQ----KLISRCWDGDPSIR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 80/276 (29%)
PKc_like 19..268 CDD:304357 78/271 (29%)
mosNP_991143.1 STKc_Mos 56..329 CDD:270881 81/281 (29%)
S_TKc 63..320 CDD:214567 79/274 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.