DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Mlkl

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001297542.1 Gene:Mlkl / 74568 MGIID:1921818 Length:472 Species:Mus musculus


Alignment Length:309 Identity:72/309 - (23%)
Similarity:131/309 - (42%) Gaps:72/309 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PVEGVPYEEIQTKEL-----------IGTGFYGSVYRAVWRNREIALKRIRE-GCEDKKIER--- 53
            |.:.:| :::|.||:           :.|....::||..:....:.:|.... ..|...|.|   
Mouse   173 PTQEIP-QDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTF 236

  Fly    54 --EIYQLTKASHVNIVELYGTSRHEGCA---------LLLMEFVDGGSLSSFLHAKSKPSYSHAH 107
              ||..:.|....||:.::|.     |.         .::||:.:.|:|...|..:...:.|...
Mouse   237 NDEIKTMKKFDSPNILRIFGI-----CIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRS 296

  Fly   108 AFNWAHQIAQGIAYLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGTVVDLSQ---SISCNAG 169
            ..  ..:.|:|:..||..:   .:||:|.. ::.|...|.::|:..|    :||:   |||..|.
Mouse   297 LL--VLRAARGLYRLHHSE---TLHRNISS-SSFLVAGGYQVKLAGF----ELSKTQNSISRTAK 351

  Fly   170 TCR--------YKAPEVLQGNKP----DEKCDVYSWAITFWEILSRKEPFEQYNT--LFELYMAI 220
            :.:        |.:||.|:  .|    |.|.::||:.|..|||.:.|.|||..::  :.|| :|.
Mouse   352 STKAERSSSTIYVSPERLK--NPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIREL-VAE 413

  Fly   221 NEGERPDLSCIMSGCPADIVALLYASWDPDISKRFSMELISQSMGRILS 269
            ::.:.|    :...||..:..::......:.|:|.|::      ||.||
Mouse   414 DKKQEP----VGQDCPELLREIINECRAHEPSQRPSVD------GRSLS 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 66/286 (23%)
PKc_like 19..268 CDD:304357 65/280 (23%)
MlklNP_001297542.1 N-terminal bundle and brace (NBB), mediates INSP6 binding. /evidence=ECO:0000250|UniProtKB:Q8NB16 1..143
PHA02988 198..446 CDD:165291 62/269 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.