DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and map3k7

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_009292938.1 Gene:map3k7 / 553788 ZFINID:ZDB-GENE-041001-135 Length:578 Species:Danio rerio


Alignment Length:279 Identity:114/279 - (40%)
Similarity:172/279 - (61%) Gaps:8/279 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PVEGVPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIREGCEDKKIEREIYQLTKASHVNIVE 68
            |.|.:.|.:|:.:|::|.|.:|.|.:|.|:.|::|:|.|....|......|:.||::..|.|||:
Zfish    16 PFEEIDYVDIEVEEVVGRGAFGVVCKAKWKGRDVAIKTIESESEKNAFIVELRQLSRVDHPNIVK 80

  Fly    69 LYGTSRHEGCALLLMEFVDGGSLSSFLH-AKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIH 132
            |||:..:..|  |:||:.:||||.:.|| |:..|.|:.:||.:|..|.:||::|||||:|||:||
Zfish    81 LYGSCNNPVC--LVMEYAEGGSLYNVLHGAEPLPHYTASHAMSWCLQCSQGVSYLHGMKPKALIH 143

  Fly   133 RDIKPLNTLLCEKGLKLKICDFGTVVDLSQSISCNAGTCRYKAPEVLQGNKPDEKCDVYSWAITF 197
            ||:||.|.||...|..||||||||..|:...::.|.|:..:.||||.:|:...|||||:||.|..
Zfish   144 RDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIIL 208

  Fly   198 WEILSRKEPFEQY-NTLFELYMAINEGERPDLSCIMSGCPADIVALLYASWDPDISKRFSMELIS 261
            ||:::|::||::. ...|.:..|::.|.||.|   :...|..|.:|:...|..|.|:|.|||.|.
Zfish   209 WEVITRRKPFDEIGGPAFRIMWAVHRGTRPPL---IKNLPKAIESLMTRCWSKDPSQRPSMEEIV 270

  Fly   262 QSMGRILSE-AGSIPPLDF 279
            :.|..::.. .||..||.:
Zfish   271 KIMSHLMGYFPGSEEPLKY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 102/245 (42%)
PKc_like 19..268 CDD:304357 105/250 (42%)
map3k7XP_009292938.1 TyrKc 25..273 CDD:197581 106/252 (42%)
STKc_TAK1 31..281 CDD:270960 105/254 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346131at33208
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.