DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Ilk

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster


Alignment Length:261 Identity:61/261 - (23%)
Similarity:109/261 - (41%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GSVYRAVWRNREIALK--RIREGCE---DKKIEREIYQLTKASHVNIVELYGTSRHEGCALLLME 84
            |..:|..|:..::..|  .:|: |.   .:....|..:|...||.||:.:.|........:.:.:
  Fly   204 GETWRGRWQKNDVVAKILAVRQ-CTPRISRDFNEEFPKLRIFSHPNILPIIGACNSPPNLVTISQ 267

  Fly    85 FVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIKP---LNTLLCEKG 146
            |:...||.|.||..:......:.|.::|..:|:|:|:||.::       .|.|   ||:      
  Fly   268 FMPRSSLFSLLHGATGVVVDTSQAVSFALDVARGMAFLHSLE-------RIIPTYHLNS------ 319

  Fly   147 LKLKICDFGTVVDLSQSISCNAGTCRYK-------------APEVLQGNKPD---EKCDVYSWAI 195
                   ...::|...:...|.|..::.             :||.||..:.|   |.||::|:||
  Fly   320 -------HHVMIDDDLTARINMGDAKFSFQEKGRIYQPAWMSPETLQRKQADRNWEACDMWSFAI 377

  Fly   196 TFWEILSRKEPFEQYNTLFELYMAIN-EGERPDLSCIMSGCPADIVALLYASWDPDISKRFSMEL 259
            ..||:.:|:.||.:::.: |..|.|. ||.|..   |..|....:..|:....:.|..||...::
  Fly   378 LIWELTTREVPFAEWSPM-ECGMKIALEGLRVK---IPPGTSTHMAKLISICMNEDPGKRPKFDM 438

  Fly   260 I 260
            :
  Fly   439 V 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 61/257 (24%)
PKc_like 19..268 CDD:304357 61/261 (23%)
IlkNP_525001.2 ANK 28..140 CDD:238125
ANK repeat 33..64 CDD:293786
Ank_2 38..130 CDD:289560
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 61/261 (23%)
STYKc 204..443 CDD:214568 61/261 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.