DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Pbk

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_075698.1 Gene:Pbk / 52033 MGIID:1289156 Length:330 Species:Mus musculus


Alignment Length:270 Identity:72/270 - (26%)
Similarity:116/270 - (42%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAPVEGVPYEEIQTKELIGTGFYGSVY----------RAVWRNREIALKRIREGCED-------K 49
            |.|...:|......|...|||.  |||          .:.|     |:|:|...|:|       |
Mouse    22 STPCVNIPASPFMQKLGFGTGV--SVYLMKRSPRGLSHSPW-----AVKKISLLCDDHYRTVYQK 79

  Fly    50 KIEREIYQLTKASHVNIVELYG-TSRHEGCALLLMEFVDGGSLSSFLHAKSKPS---YSHAHAFN 110
            ::..|...|...:|.||:.... |...:|...|.||:....||:..:..::|.|   :..|....
Mouse    80 RLTDEAKILKNLNHPNIIGYRAFTEASDGSLCLAMEYGGEKSLNDLIEERNKDSGSPFPAAVILR 144

  Fly   111 WAHQIAQGIAYLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGTVVDLSQSI------SCNAG 169
            .|..:|:|:.|||  |.|.::|.|||..|.::......:||||.|..:.|.:::      :|..|
Mouse   145 VALHMARGLKYLH--QEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIG 207

  Fly   170 TCRYKAPEVLQGNK-PDEKCDVYSWAITFWEILSRKEP--------------FEQYNTLFELYMA 219
            |..:|..|.|:.|. ..:|.||:::.:|.||:::...|              |::.:...|.|.|
Mouse   208 TEPWKPKEALEENGIITDKADVFAFGLTLWEMMTLCIPHVNLPDDDVDEDATFDESDFDDEAYYA 272

  Fly   220 INEGERPDLS 229
            . .|.||.::
Mouse   273 A-LGTRPSIN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 69/258 (27%)
PKc_like 19..268 CDD:304357 68/253 (27%)
PbkNP_075698.1 PKc_TOPK 31..318 CDD:270903 69/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.