DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and MAP3K20

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_057737.2 Gene:MAP3K20 / 51776 HGNCID:17797 Length:800 Species:Homo sapiens


Alignment Length:278 Identity:92/278 - (33%)
Similarity:142/278 - (51%) Gaps:28/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPYEEIQTKELIGTGFYGSVYRAVW--RNREIALKRIREGCEDKKIEREIYQLTKASHVNIVELY 70
            :.::::|..|..|.|.:||||||.|  :::|:|:|::      .|||:|...|:..||.||::.|
Human    11 IKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKL------LKIEKEAEILSVLSHRNIIQFY 69

  Fly    71 GTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDI 135
            |.........::.|:...|||..::::.........|...||..:|:|:.|||...|..|||||:
Human    70 GVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDL 134

  Fly   136 KPLNTLLCEKGLKLKICDFG--------TVVDLSQSISCNAGTCRYKAPEVLQGNKPDEKCDVYS 192
            |..|.::...|: |||||||        |.:.|       .||..:.||||:|.....|.||.||
Human   135 KSRNVVIAADGV-LKICDFGASRFHNHTTHMSL-------VGTFPWMAPEVIQSLPVSETCDTYS 191

  Fly   193 WAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIVALLYASWDPDISKRFSM 257
            :.:..||:|:|:.||:....|...::.:.:.||   ..|.|.||.....||:..|:.|..||.|.
Human   192 YGVVLWEMLTREVPFKGLEGLQVAWLVVEKNER---LTIPSSCPRSFAELLHQCWEADAKKRPSF 253

  Fly   258 ELISQSMGRILSEAGSIP 275
            :.|. |:...:|...|:|
Human   254 KQII-SILESMSNDTSLP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 87/253 (34%)
PKc_like 19..268 CDD:304357 87/258 (34%)
MAP3K20NP_057737.2 STKc_MLTK 22..263 CDD:270962 87/258 (34%)
STYKc 23..260 CDD:214568 87/254 (34%)
Leucine-zipper 287..308
SAM_MLTK 338..408 CDD:188928
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 652..800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.