DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Map3k9

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_038968662.1 Gene:Map3k9 / 500690 RGDID:1562149 Length:1140 Species:Rattus norvegicus


Alignment Length:312 Identity:96/312 - (30%)
Similarity:143/312 - (45%) Gaps:49/312 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIR--------EGCEDKKIEREIYQLTKASHV 64
            :.:.|:..:|:||.|.:|.||||.|...|:|:|..|        :..|:.:.|.:::.:.|  |.
  Rat   132 IDFAELTLEEIIGIGGFGKVYRAFWVGDEVAVKAARHDPDEDISQTIENVRQEAKLFAMLK--HP 194

  Fly    65 NIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKA 129
            ||:.|.|....|....|:|||..||.|:..|..|..|.   ....|||.|||:|:.|||......
  Rat   195 NIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRVPP---DILVNWAVQIARGMNYLHDEAIVP 256

  Fly   130 VIHRDIKPLNT---------------LLCE------------KGLKLKICDFGTVVDLSQSISCN 167
            |||||:|..|:               .|||            ....|||.|||...:..::...:
  Rat   257 VIHRDLKSSNSECGELGWGEQHSLSLRLCEVLILQKVENGDLSNKTLKITDFGLAREWHRTTKMS 321

  Fly   168 -AGTCRYKAPEVLQGNKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELY-MAINEGERPDLSC 230
             |||..:.||||::.:...:..||:|:.:..||:|:.:.||...:.|...| :|:|:...|    
  Rat   322 AAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALP---- 382

  Fly   231 IMSGCPADIVALLYASWDPDISKRFSMELISQSMGRILSEAG--SIPPLDFY 280
            |.|.||.....|:...|:||...|.|...|...:..| .|:|  .:|...|:
  Rat   383 IPSTCPEPFAKLMEDCWNPDPHSRPSFSSILDQLTTI-EESGFFEMPKDSFH 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 89/280 (32%)
PKc_like 19..268 CDD:304357 89/285 (31%)
Map3k9XP_038968662.1 SH3_MLK1-3 49..106 CDD:212992
STKc_MLK1 130..419 CDD:271047 91/295 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.