Sequence 1: | NP_651090.2 | Gene: | Takl2 / 42692 | FlyBaseID: | FBgn0039015 | Length: | 281 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_796040.3 | Gene: | Tnni3k / 435766 | MGIID: | 2443276 | Length: | 834 | Species: | Mus musculus |
Alignment Length: | 291 | Identity: | 84/291 - (28%) |
---|---|---|---|
Similarity: | 135/291 - (46%) | Gaps: | 36/291 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 EIQTKELIGTGFYGSVYRAVWRNREIALKRIREG--CEDKKIE---REIYQLTKASHVNIVELYG 71
Fly 72 TSRHEGCAL-LLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGM-QPKAVIHRD 134
Fly 135 IKPLNTLLCEKGLKLKICDFGTVVDL----SQSISCNAGTCRYKAPEVL-QGNKPDEKCDVYSWA 194
Fly 195 ITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIVALLYASWD--PDISKRFS- 256
Fly 257 -----------MELISQSMGRILSEAGSIPP 276 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Takl2 | NP_651090.2 | S_TKc | 14..258 | CDD:214567 | 76/269 (28%) |
PKc_like | 19..268 | CDD:304357 | 78/274 (28%) | ||
Tnni3k | NP_796040.3 | ANK repeat | 66..98 | CDD:293786 | |
ANK 1 | 66..96 | ||||
Ank_2 | 71..164 | CDD:289560 | |||
ANK | 99..220 | CDD:238125 | |||
ANK repeat | 100..131 | CDD:293786 | |||
ANK 2 | 100..129 | ||||
ANK 3 | 133..162 | ||||
ANK repeat | 134..164 | CDD:293786 | |||
Ank_2 | 138..231 | CDD:289560 | |||
ANK | 161..289 | CDD:238125 | |||
ANK repeat | 166..197 | CDD:293786 | |||
ANK 4 | 166..195 | ||||
ANK repeat | 199..231 | CDD:293786 | |||
ANK 5 | 199..229 | ||||
ANK | 228..359 | CDD:238125 | |||
ANK 6 | 233..262 | ||||
Ank_4 | 237..286 | CDD:290365 | |||
ANK repeat | 268..301 | CDD:293786 | |||
ANK 7 | 268..297 | ||||
Ank_2 | 273..368 | CDD:289560 | |||
ANK repeat | 303..336 | CDD:293786 | |||
ANK 8 | 303..334 | ||||
ANK | 333..>400 | CDD:238125 | |||
ANK repeat | 338..368 | CDD:293786 | |||
ANK 9 | 338..367 | ||||
Ank_4 | 339..400 | CDD:290365 | |||
ANK 10 | 380..409 | ||||
TyrKc | 462..718 | CDD:197581 | 77/262 (29%) | ||
PKc_TNNI3K | 468..721 | CDD:270966 | 75/259 (29%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 815..834 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0192 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |