DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and MAP3K10

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_011525283.1 Gene:MAP3K10 / 4294 HGNCID:6849 Length:962 Species:Homo sapiens


Alignment Length:301 Identity:95/301 - (31%)
Similarity:147/301 - (48%) Gaps:54/301 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAPVEGVPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIR------------EGCEDKKIER 53
            :..|.| :|:.|:|.:|:||.|.:|.||||:||..|:|:|..|            :.|::.::  
Human    87 LQLPQE-IPFHELQLEEIIGVGGFGKVYRALWRGEEVAVKAARLDPEKDPAVTAEQVCQEARL-- 148

  Fly    54 EIYQLTKASHVNIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQG 118
                .....|.||:.|.|...:.....|:||:..||:||..|..:..|.:.   ..|||.|:|:|
Human   149 ----FGALQHPNIIALRGACLNPPHLCLVMEYARGGALSRVLAGRRVPPHV---LVNWAVQVARG 206

  Fly   119 IAYLHGMQPKAVIHRDIKPLNTLLCE-------KGLKLKICDFGTVVDLSQSISCN-AGTCRYKA 175
            :.|||...|..:||||:|.:|.|:.|       ....|||.|||...:..::...: |||..:.|
Human   207 MNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWMA 271

  Fly   176 PEVLQGNKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELY-MAINEGERPDLSCIMSGCPADI 239
            |||::.:...:..||:|:.:..||:|:.:.|:.:.:.|...| :|:|:...|    |.|.||...
Human   272 PEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLP----IPSTCPEPF 332

  Fly   240 VALLYAS--------WDPD---------ISKRFSMELISQS 263
            ..||...        ||||         |.||  :|:|.||
Human   333 ARLLEGEPGPRDEECWDPDPHGRPDFGSILKR--LEVIEQS 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 87/281 (31%)
PKc_like 19..268 CDD:304357 89/283 (31%)
MAP3K10XP_011525283.1 SH3_MLK1-3 20..76 CDD:212992
TyrKc 98..365 CDD:197581 87/281 (31%)
PKc_like 103..368 CDD:304357 86/279 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.