DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and MAP3K9

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_011535090.1 Gene:MAP3K9 / 4293 HGNCID:6861 Length:1166 Species:Homo sapiens


Alignment Length:290 Identity:92/290 - (31%)
Similarity:140/290 - (48%) Gaps:33/290 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIR--------EGCEDKKIEREIYQLTKASHV 64
            :.:.|:..:|:||.|.:|.||||.|...|:|:|..|        :..|:.:.|.:::.:.|  |.
Human   139 IDFAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDEDISQTIENVRQEAKLFAMLK--HP 201

  Fly    65 NIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKA 129
            ||:.|.|....|....|:|||..||.|:..|..|..|.   ....|||.|||:|:.|||......
Human   202 NIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPP---DILVNWAVQIARGMNYLHDEAIVP 263

  Fly   130 VIHRDIKPLNTLLCEK-------GLKLKICDFGTVVDLSQSISCN-AGTCRYKAPEVLQGNKPDE 186
            :||||:|..|.|:.:|       ...|||.|||...:..::...: |||..:.||||::.:...:
Human   264 IIHRDLKSSNILILQKVENGDLSNKILKITDFGLAREWHRTTKMSAAGTYAWMAPEVIRASMFSK 328

  Fly   187 KCDVYSWAITFWEILSRKEPFEQYNTLFELY-MAINEGERPDLSCIMSGCPADIVALLYASWDPD 250
            ..||:|:.:..||:|:.:.||...:.|...| :|:|:...|    |.|.||.....|:...|:||
Human   329 GSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALP----IPSTCPEPFAKLMEDCWNPD 389

  Fly   251 ISKRFSMELISQSMGRILSEAGSIPPLDFY 280
            ...|       .|...||.:..:|....|:
Human   390 PHSR-------PSFTNILDQLTTIEESGFF 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 86/260 (33%)
PKc_like 19..268 CDD:304357 86/265 (32%)
MAP3K9XP_011535090.1 SH3_MLK1-3 56..113 CDD:212992
STKc_MLK1 137..406 CDD:271047 90/282 (32%)
TyrKc 144..403 CDD:197581 89/274 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.