DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Lrrk

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001262772.1 Gene:Lrrk / 42447 FlyBaseID:FBgn0038816 Length:2513 Species:Drosophila melanogaster


Alignment Length:332 Identity:82/332 - (24%)
Similarity:138/332 - (41%) Gaps:81/332 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPYEEIQTKELIGTGFYGSVYRAVWRNR------EIALKRIR---EGCEDKK------------- 50
            :|.|.|....|:|.|.:|.|::|..:.|      .:|:|.::   .|...|:             
  Fly  1791 IPSECIIKGSLLGRGAFGFVFKANCKVRGARSFKPVAMKMLQPVPPGARAKESALMAFKVAVGKW 1855

  Fly    51 --------------IEREIYQLTKASHVNIVELYGTSRHEGC---ALLLMEFVDGGSLSSFL-HA 97
                          ..:|:..|....|.|||.|.|.     |   ..|::|....|.|.:.| |.
  Fly  1856 DRDPLQHSCKAYCTARQELAVLLTLKHPNIVPLVGI-----CIKPLALVLELAPLGGLDALLRHY 1915

  Fly    98 KSKPSYSHAHAF-NWAHQIAQGIAYLHGMQPKAVIHRDIKPLNTLLCE-----------KGLKLK 150
            :...::...|.| ....|.|:.|.|||   .:.:|:||:|..|.|:.|           ..:.:|
  Fly  1916 RRSGAHMGPHTFQTLVLQAARAIEYLH---RRRIIYRDLKSENVLVWELPQPHTEDSPRNLVHIK 1977

  Fly   151 ICDFGTVVDLSQSISCN-----AGTCRYKAPEVLQGNKPD---EKCDVYSWAITFWEILSRKEPF 207
            |.|:|    :|:..:.:     .||..:.|||:::.|..:   ||.|.:|:.:..:|.:|.::||
  Fly  1978 IADYG----ISRQTAPSGAKGFGGTEGFMAPEIIRYNGEEEYTEKVDCFSFGMFIYENISLRQPF 2038

  Fly   208 EQYNTLFELYMAINEGERPDLSCIMSGCPADIVALLYASWDPDISKR-FSMELISQSMGRILSEA 271
            |.:.::.|   .|.||.||.|:...:..|...:.|:...|.....:| .:.:::|     |||..
  Fly  2039 EGHESIKE---CILEGSRPALTQRETQFPTCCLDLMVLCWHEQPRRRPTASQIVS-----ILSAP 2095

  Fly   272 GSIPPLD 278
            ..|..||
  Fly  2096 ECIHLLD 2102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 72/304 (24%)
PKc_like 19..268 CDD:304357 72/309 (23%)
LrrkNP_001262772.1 Ank_2 111..200 CDD:289560
ANK 146..286 CDD:238125
ANK repeat 146..177 CDD:293786
Ank_4 179..232 CDD:290365
ANK repeat 179..209 CDD:293786
Ank_2 216..389 CDD:289560
ANK 361..477 CDD:238125
ANK repeat 361..390 CDD:293786
Ank_2 364..464 CDD:289560
ANK repeat 406..435 CDD:293786
ANK repeat 437..464 CDD:293786
LRR_8 <544..580 CDD:290566
leucine-rich repeat 547..569 CDD:275380
LRR_8 569..629 CDD:290566
leucine-rich repeat 570..595 CDD:275380
leucine-rich repeat 596..618 CDD:275380
leucine-rich repeat 619..641 CDD:275380
leucine-rich repeat 642..676 CDD:275380
leucine-rich repeat 677..730 CDD:275380
LRR_8 729..788 CDD:290566
leucine-rich repeat 731..754 CDD:275380
LRR_8 855..933 CDD:290566
leucine-rich repeat 855..901 CDD:275380
leucine-rich repeat 902..924 CDD:275380
leucine-rich repeat 925..949 CDD:275380
P-loop_NTPase 993..1211 CDD:304359
COR 1230..1471 CDD:292713
STYKc 1796..2092 CDD:214568 74/315 (23%)
STKc_LRRK 1801..2095 CDD:270902 76/313 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445231
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.