DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and ksr

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001287177.1 Gene:ksr / 40660 FlyBaseID:FBgn0015402 Length:966 Species:Drosophila melanogaster


Alignment Length:295 Identity:75/295 - (25%)
Similarity:133/295 - (45%) Gaps:51/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIREG-CEDKKI----EREIYQLTKASHVNIV 67
            :||.::...|.||.|.:|:|:||:|.. ::|:|.:.|. .:|:.:    ..|:.......|.|:|
  Fly   674 IPYGDLLLLERIGQGRFGTVHRALWHG-DVAVKLLNEDYLQDEHMLETFRSEVANFKNTRHENLV 737

  Fly    68 ELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIH 132
            ...|...:.....::.....|.:|.:::|.: :..::.......|.|||||:.|||.   :.:||
  Fly   738 LFMGACMNPPYLAIVTSLCKGNTLYTYIHQR-REKFAMNRTLLIAQQIAQGMGYLHA---REIIH 798

  Fly   133 RDIKPLNTLLCEKGLKLKICDFGTVVDLSQSISCNAG-------TCRYKAPEV---LQGNKPDEK 187
            :|::..| :..|.| |:.|.||| :...::.:.|:.|       .| |.|||:   ||..||..:
  Fly   799 KDLRTKN-IFIENG-KVIITDFG-LFSSTKLLYCDMGLGVPHNWLC-YLAPELIRALQPEKPRGE 859

  Fly   188 C-------DVYSWAITFWEILS-----RKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIV 240
            |       ||||:...::|::.     :.:|.|      .:...:..|.:..|:.:.||  .|:.
  Fly   860 CLEFTPYSDVYSFGTVWYELICGEFTFKDQPAE------SIIWQVGRGMKQSLANLQSG--RDVK 916

  Fly   241 ALLYASWDPDISKRFSMELISQSMGRILSEAGSIP 275
            .||...|..:...|       ....|:||....:|
  Fly   917 DLLMLCWTYEKEHR-------PQFARLLSLLEHLP 944

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 69/270 (26%)
PKc_like 19..268 CDD:304357 69/275 (25%)
ksrNP_001287177.1 KSR1-SAM 33..166 CDD:290277
C1_1 368..419 CDD:278556
PK_KSR 678..946 CDD:270965 73/291 (25%)
Pkinase_Tyr 679..940 CDD:285015 72/284 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445261
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23257
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.