DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and LOC405768

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001353900.1 Gene:LOC405768 / 405768 -ID:- Length:477 Species:Danio rerio


Alignment Length:257 Identity:87/257 - (33%)
Similarity:136/257 - (52%) Gaps:13/257 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAPVEGVPYEEIQTKELIGTGFYGSVYRAVW--RNREIALKRIREGCEDKKIEREIYQLTKASH 63
            :||....:|:::|:..|..|.|.:||||||.|  :::|:|:|::      .||:.|...|:..||
Zfish    35 LSASFVQIPFDDIRFYENCGGGSFGSVYRAHWVPQDKEVAVKKL------LKIDAEAEILSVLSH 93

  Fly    64 VNIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPK 128
            .||::.||.........::.|:...|||..:|.:.............||.:||:|:.|||...|.
Zfish    94 KNIIQFYGAILEAPNYGIVTEYASRGSLYEYLSSADSEEMDMDQVMTWAMEIAKGMHYLHAEAPL 158

  Fly   129 AVIHRDIKPLNTLLCEKGLKLKICDFGTVVDLSQSISCN-AGTCRYKAPEVLQGNKPDEKCDVYS 192
            .|||||:|..|.:|....: |||||||....:|.:...: .||..:.||||:|.....|.||.||
Zfish   159 KVIHRDLKSRNVVLTADNV-LKICDFGASKMVSHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYS 222

  Fly   193 WAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIVALLYASWDPDISKR 254
            :.:..||:|:|:.||:.:..|...::.:.:.|||   .|.|.|||....|:...|:.:..:|
Zfish   223 YGVVLWEMLTREVPFKGFEGLQVAWLVVEKHERP---TIPSSCPASFADLMRRCWNAEPKER 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 83/244 (34%)
PKc_like 19..268 CDD:304357 82/239 (34%)
LOC405768NP_001353900.1 STKc_MLTK 53..294 CDD:270962 82/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.