DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Mos

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster


Alignment Length:273 Identity:74/273 - (27%)
Similarity:117/273 - (42%) Gaps:50/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EGVPYEEIQTK-ELIGTGFYGSVYRAVWRNREIALKRIREGCEDKKIEREIYQLTKASHVNIVEL 69
            :|.|   :.|: :::|.|.||:|::|::|:|.:|:|.||.... ..:..|.: |....|.|||.|
  Fly    17 DGPP---VPTRCQVLGRGAYGTVFKAIYRDRSVAVKIIRAQAA-STLHNESH-LLNLEHRNIVRL 76

  Fly    70 YGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRD 134
            ..........|::||...|.||...:...:.|.   .|.......:...:.|.|...   |:|.|
  Fly    77 LKLESAADFGLVIMECPRGQSLQRIVDTLALPL---MHRVLITLDVVAALRYCHSQN---VLHLD 135

  Fly   135 IKPLNTLLC----------------EKGLKLKICDFGTVVDLS-----QSISCNAGTCRYKAPEV 178
            :||.|.|:.                ::....|:||||:.:::.     |..|...||.||.:||.
  Fly   136 VKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSVAKGTLRYMSPEA 200

  Fly   179 LQGNKPDEKCDVYSWAITFWEILSRKEPFEQYNTL----FELYMAINEGERPD----LSCIMSGC 235
            |:.:...|..|:||..||.|::.:|:.|   |:||    ...|..:....|||    |..:....
  Fly   201 LRSDTLTEASDIYSLGITMWQLQARRLP---YHTLDCNETIAYQVVKHELRPDNYHQLKILALDS 262

  Fly   236 PADIVALLYASWD 248
            |.|      ..||
  Fly   263 PID------CDWD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 72/265 (27%)
PKc_like 19..268 CDD:304357 71/259 (27%)
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 73/271 (27%)
S_TKc 26..257 CDD:214567 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444232
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23257
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.