Sequence 1: | NP_651090.2 | Gene: | Takl2 / 42692 | FlyBaseID: | FBgn0039015 | Length: | 281 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001015359.1 | Gene: | CG41099 / 3355072 | FlyBaseID: | FBgn0039955 | Length: | 1124 | Species: | Drosophila melanogaster |
Alignment Length: | 321 | Identity: | 61/321 - (19%) |
---|---|---|---|
Similarity: | 115/321 - (35%) | Gaps: | 118/321 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 VYRAVWRNRE-IALKRIREGCE--------------DKKIEREIYQLTKASHVNIVELYGTSRHE 76
Fly 77 GCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIKPLNTL 141
Fly 142 LCEKGLKLKICD------FGTVVDLSQSISCNAGTCRY--KAPEV-LQGN--------KPDEKCD 189
Fly 190 VYSWAITFWEILSRKEPFEQYNTL------------------------------FELYMAINEGE 224
Fly 225 RPDLSCIMSGCPADIVALLYASWDPD------ISKRFSM-----ELISQSMGRILSEAGSI 274 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Takl2 | NP_651090.2 | S_TKc | 14..258 | CDD:214567 | 55/303 (18%) |
PKc_like | 19..268 | CDD:304357 | 59/313 (19%) | ||
CG41099 | NP_001015359.1 | BTB | 67..164 | CDD:279045 | |
BTB | 75..166 | CDD:197585 | |||
ANK | 252..385 | CDD:238125 | |||
ANK repeat | 291..322 | CDD:293786 | |||
ANK repeat | 325..362 | CDD:293786 | |||
Ank_2 | 330..431 | CDD:289560 | |||
ANK | 463..595 | CDD:238125 | |||
ANK repeat | 468..501 | CDD:293786 | |||
Ank_2 | 473..572 | CDD:289560 | |||
ANK repeat | 503..539 | CDD:293786 | |||
ANK | 536..660 | CDD:238125 | |||
ANK repeat | 541..572 | CDD:293786 | |||
ANK repeat | 574..637 | CDD:293786 | |||
Ank_2 | 579..670 | CDD:289560 | |||
ANK repeat | 639..670 | CDD:293786 | |||
Ank_2 | 644..752 | CDD:289560 | 16/83 (19%) | ||
ANK repeat | 672..721 | CDD:293786 | 8/39 (21%) | ||
ANK | 721..843 | CDD:238125 | 28/157 (18%) | ||
ANK repeat | 723..752 | CDD:293786 | 7/34 (21%) | ||
ANKYR | 752..977 | CDD:223738 | 45/237 (19%) | ||
ANK repeat | 754..786 | CDD:293786 | 10/54 (19%) | ||
ANK | 820..944 | CDD:238125 | 23/130 (18%) | ||
ANK repeat | 822..855 | CDD:293786 | 7/33 (21%) | ||
ANK repeat | 857..888 | CDD:293786 | 2/30 (7%) | ||
ANK | 885..1017 | CDD:238125 | 19/80 (24%) | ||
ANK repeat | 890..921 | CDD:293786 | 9/36 (25%) | ||
ANK repeat | 923..955 | CDD:293786 | 9/33 (27%) | ||
ANK repeat | 996..1021 | CDD:293786 | |||
FYVE_ANFY1 | 1054..1116 | CDD:277267 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0192 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |