DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and LIMK1

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_511139.2 Gene:LIMK1 / 32207 FlyBaseID:FBgn0283712 Length:1257 Species:Drosophila melanogaster


Alignment Length:313 Identity:80/313 - (25%)
Similarity:128/313 - (40%) Gaps:70/313 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ELIGTGFYGSVYRAVWR--NREIALKRIREGCED--KKIEREIYQLTKASHVNIVELYGTSRHEG 77
            |.:|.||:|.|::...|  ...:.||.:....|:  :...:|:..|....|.::::..|....:.
  Fly   405 EKLGEGFFGKVFKVTHRQSGEVMVLKELHRADEEAQRNFIKEVAVLRLLDHRHVLKFIGVLYKDK 469

  Fly    78 CALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNW------AHQIAQGIAYLHGMQPKAVIHRDIK 136
            ...::.|:|.||.|...:|       ..|....|      |..||.|::|||.|.   :||||:.
  Fly   470 KLHMVTEYVAGGCLKELIH-------DPAQVLPWPQRVRLARDIACGMSYLHSMN---IIHRDLN 524

  Fly   137 PLNTLLCEKGLKLKICDFGTV--VDLSQSISCN------------------AGTCR--------- 172
            .:|.|:.| ...:.:.|||..  ||..:..|.|                  :||.|         
  Fly   525 SMNCLVRE-DRSVIVADFGLARSVDAPRLPSGNMTPGGYGSGANSDAPMSPSGTLRRSKSRQRRQ 588

  Fly   173 ---------YKAPEVLQGNKPDEKCDVYSWAITFWEILSRKE---PFEQYNTLFELYMAINEGER 225
                     :.|||:::|.|.|||.||:|:.|...||:.|.|   .|...|:.|.|    |:.|.
  Fly   589 RYTVVGNPYWMAPEMMKGLKYDEKVDVFSFGIMLCEIIGRVEADPDFMPRNSDFSL----NQQEF 649

  Fly   226 PDLSCIMSGCPADIVALLYASWDPDISKRFSMELISQSMGRILSE--AGSIPP 276
            .:..|  :.||...|.:.:...|.:...|...|.:...:.|:..:  |..:||
  Fly   650 REKFC--AQCPEPFVKVAFVCCDLNPDMRPCFETLHVWLQRLADDLAADRVPP 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 75/291 (26%)
PKc_like 19..268 CDD:304357 76/299 (25%)
LIMK1NP_511139.2 LIM1_LIMK 33..88 CDD:188750
LIM2_LIMK 95..148 CDD:188751
PDZ_signaling 172..271 CDD:238492
STKc_LIMK 407..693 CDD:271056 76/302 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.