DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Takl1

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_732554.1 Gene:Takl1 / 318725 FlyBaseID:FBgn0046689 Length:393 Species:Drosophila melanogaster


Alignment Length:285 Identity:105/285 - (36%)
Similarity:164/285 - (57%) Gaps:14/285 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VEGVPYEEIQTKE-LIGTGFYGSVYRAVWRNREIALKRIREGCED---KKIEREIYQLTKASHVN 65
            |:.|.:.|::..| .:|.|..|:|.:|.::|:|||:| |.:..|:   |..||||..|::..|.|
  Fly     2 VKQVDFAEVKLSEKFLGAGSGGAVRKATFQNQEIAVK-IFDFLEETIKKNAEREITHLSEIDHEN 65

  Fly    66 IVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAV 130
            ::.:.|.:.:.....||||:::.|||.::|:...|..|:...|..||.|.|:.:||||.:. :.:
  Fly    66 VIRVIGRASNGKKDYLLMEYLEEGSLHNYLYGDDKWEYTVEQAVRWALQCAKALAYLHSLD-RPI 129

  Fly   131 IHRDIKPLNTLLCEKGLKLKICDFGTVVDLSQSISCNAGTCRYKAPEVLQGNKPDEKCDVYSWAI 195
            :||||||.|.||..:...|||||||...|:|.:.:...||.||.|||.::..|...||||||:.|
  Fly   130 VHRDIKPQNMLLYNQHEDLKICDFGLATDMSNNKTDMQGTLRYMAPEAIKHLKYTAKCDVYSFGI 194

  Fly   196 TFWEILSRKEPF---EQYNTLFELYMAINEGERPDLSCIMSGCPADIVALLYASWDPDISKRFSM 257
            ..||:::|:.|:   |..|:.:.:..||:.||:..:..:.|.||..|..|:....|.:..||.||
  Fly   195 MLWELMTRQLPYSHLENPNSQYAIMKAISSGEKLPMEAVRSDCPEGIKQLMECCMDINPEKRPSM 259

  Fly   258 ELISQSMGRILSEAGS----IPPLD 278
            :.|.:.:|. ..|:|:    |.|||
  Fly   260 KEIEKFLGE-QYESGTDEDFIKPLD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 93/250 (37%)
PKc_like 19..268 CDD:304357 95/254 (37%)
Takl1NP_732554.1 S_TKc 15..262 CDD:214567 93/248 (38%)
STKc_TAK1 17..274 CDD:270960 96/259 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444229
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I3316
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346131at33208
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.