DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Map3k11

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001013168.1 Gene:Map3k11 / 309168 RGDID:1359261 Length:850 Species:Rattus norvegicus


Alignment Length:297 Identity:90/297 - (30%)
Similarity:143/297 - (48%) Gaps:29/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PVEGVPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIREGCED------KKIEREIYQLTKAS 62
            |.|...::|::.:|:||.|.:|.|||..||...:|:|..|:..::      :.:.:|.......:
  Rat   109 PCEVASFQELRLEEVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLA 173

  Fly    63 HVNIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQP 127
            |.||:.|......|....|:||:..||.||..|..:..|.:.   ..|||.|||:|:.|||....
  Rat   174 HPNIIALKAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHV---LVNWAVQIARGMHYLHCEAL 235

  Fly   128 KAVIHRDIKPLNTLLCE-------KGLKLKICDFGTVVDLSQSISCN-AGTCRYKAPEVLQGNKP 184
            ..|||||:|..|.||.:       :...|||.|||...:..::...: |||..:.||||::.:..
  Rat   236 VPVIHRDLKSNNILLLQPIEGDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTF 300

  Fly   185 DEKCDVYSWAITFWEILSRKEPFEQYNTLFELY-MAINEGERPDLSCIMSGCPADIVALLYASWD 248
            .:..||:|:.:..||:|:.:.|:...:.|...| :|:|:...|    |.|.||.....|:...|.
  Rat   301 SKGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLP----IPSTCPEPFAQLMADCWA 361

  Fly   249 PDISKRFSMELISQSM----GRILSEAGSIPPLDFYS 281
            .|..:|.....|.|.:    .::|.|   :|...|:|
  Rat   362 QDPHRRPDFASILQQLEALEAQVLRE---MPRDSFHS 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 80/258 (31%)
PKc_like 19..268 CDD:304357 81/267 (30%)
Map3k11NP_001013168.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..37
SH3_MLK1-3 46..103 CDD:212992
STKc_MLK3 114..380 CDD:271049 83/272 (31%)
STYKc 118..377 CDD:214568 82/265 (31%)
Leucine-zipper 1 404..425
Leucine-zipper 2 439..460
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 536..850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.