DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Map3k10

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001382027.1 Gene:Map3k10 / 308463 RGDID:1308381 Length:940 Species:Rattus norvegicus


Alignment Length:287 Identity:95/287 - (33%)
Similarity:146/287 - (50%) Gaps:34/287 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAPVEGVPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIREGCE------DKKIEREIYQLT 59
            :..|.| :|:.|:|.:|:||.|.:|.||||:||..|:|:|..|...|      .:::.:|.....
  Rat    87 LQLPQE-IPFHELQLEEIIGVGGFGKVYRALWRGEEVAVKAARLDPERDPAVTAEQVRQEARLFG 150

  Fly    60 KASHVNIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHG 124
            ...|.||:.|.|.........|:||:..||:||..|..:..|.:.   ..|||.|:|:|:.|||.
  Rat   151 ALQHPNIIALRGACLSPPNLCLVMEYARGGALSRVLAGRRVPPHV---LVNWAVQVARGMNYLHN 212

  Fly   125 MQPKAVIHRDIKPLNTLLCE-------KGLKLKICDFGTVVDLSQSISCN-AGTCRYKAPEVLQG 181
            ..|..:||||:|.:|.|:.|       ....|||.|||...:..::...: |||..:.||||::.
  Rat   213 DAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRL 277

  Fly   182 NKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELY-MAINEGERPDLSCIMSGCPADIVALLYA 245
            :...:..||:|:.:..||:|:.:.|:.:.:.|...| :|:|:...|    |.|.||.....||..
  Rat   278 SLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLP----IPSTCPEPFARLLEE 338

  Fly   246 SWDPD---------ISKRFSMELISQS 263
            .||||         |.|:  :|:|.||
  Rat   339 CWDPDPHGRPDFGSILKQ--LEVIEQS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 87/267 (33%)
PKc_like 19..268 CDD:304357 89/269 (33%)
Map3k10NP_001382027.1 Leucine-zipper 1 384..405
Leucine-zipper 2 419..440
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 490..599
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..658
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 687..733
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 748..916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.