DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Ripk1

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001100820.1 Gene:Ripk1 / 306886 RGDID:1310158 Length:658 Species:Rattus norvegicus


Alignment Length:282 Identity:85/282 - (30%)
Similarity:131/282 - (46%) Gaps:39/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IQTKELIGTGFYGSVYRAVWRNRE-IALKRIREGCE----DKKIEREIYQLTKASHVNIVELYGT 72
            ::.|:|...|| |.|.....|... :.||::..|..    ::.:..|...:.:..|..:|:|.|.
  Rat    18 LERKDLDSGGF-GKVSLCFHRTHGFVILKKVYTGPNRAEYNEALLEEGKMMHRLRHDRVVKLLGI 81

  Fly    73 SRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIKP 137
            ...||...|:||:::.|:|...|  |:|.|...:.......:|.:|:.|||   .:.|||:|:||
  Rat    82 IIEEGNYSLVMEYMEQGNLMHVL--KTKESVPLSVKGRIIVEIIEGMHYLH---DEGVIHKDLKP 141

  Fly   138 LNTLLCEKGLKLKICDFGTVV----------------DLSQSISCNAGTCRYKAPEVLQ--GNKP 184
            .| :|.::...:||.|.|...                :.|.....|.||..|.|||.|.  ..||
  Rat   142 EN-ILVDRDFHIKIADLGVASFKTWSKLTKEEHNKQREASSVTKKNGGTLYYMAPEHLTDINTKP 205

  Fly   185 DEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIVALLYASW-- 247
            .||.||||:||..|.|.:.|||:|......:..:.||.|.||::..|:..||.:|::|:...|  
  Rat   206 TEKSDVYSFAIVLWAIFANKEPYENVICTEQFLVCINSGNRPNVEDILEFCPREIISLMERCWQT 270

  Fly   248 DPD-------ISKRFSMELISQ 262
            :|:       |.|.|....:||
  Rat   271 NPEDRPTFFGIEKEFKPFYLSQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 83/275 (30%)
PKc_like 19..268 CDD:304357 83/276 (30%)
Ripk1NP_001100820.1 PKc_like 23..290 CDD:419665 82/273 (30%)
Death_RIP1 570..655 CDD:260048
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.