DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Map3k10

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_017177776.1 Gene:Map3k10 / 269881 MGIID:1346879 Length:991 Species:Mus musculus


Alignment Length:295 Identity:96/295 - (32%)
Similarity:146/295 - (49%) Gaps:42/295 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAPVEGVPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIREGCE------DKKIEREIYQLT 59
            :..|.| :|:.|:|.:|:||.|.:|.|||||||..|:|:|..|...|      .:::.:|.....
Mouse    87 LQLPQE-IPFHELQLEEIIGVGGFGKVYRAVWRGEEVAVKAARLDPERDPAVTAEQVRQEARLFG 150

  Fly    60 KASHVNIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHG 124
            ...|.||:.|.|.........|:||:..||:||..|..:..|.:.   ..|||.|:|:|:.|||.
Mouse   151 ALQHPNIIALRGACLSPPNLCLVMEYARGGALSRVLAGRRVPPHV---LVNWAVQVARGMNYLHN 212

  Fly   125 MQPKAVIHRDIKPLNTLLCE-------KGLKLKICDFGTVVDLSQSISCN-AGTCRYKAPEVLQG 181
            ..|..:||||:|.:|.|:.|       ....|||.|||...:..::...: |||..:.||||::.
Mouse   213 DAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRL 277

  Fly   182 NKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELY-MAINEGERPDLSCIMSGCPADIVALLYA 245
            :...:..||:|:.:..||:|:.:.|:.:.:.|...| :|:|:...|    |.|.||.....||..
Mouse   278 SLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLP----IPSTCPEPFARLLEG 338

  Fly   246 S--------WDPD---------ISKRFSMELISQS 263
            .        ||||         |.|:  :|:|.||
Mouse   339 EPGPCGEECWDPDPHGRPDFGSILKQ--LEVIEQS 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 88/275 (32%)
PKc_like 19..268 CDD:304357 90/277 (32%)
Map3k10XP_017177776.1 SH3_MLK1-3 20..76 CDD:212992
PKc_like 103..368 CDD:389743 87/273 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.