DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and DSTYK

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_056190.1 Gene:DSTYK / 25778 HGNCID:29043 Length:929 Species:Homo sapiens


Alignment Length:268 Identity:74/268 - (27%)
Similarity:114/268 - (42%) Gaps:31/268 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGTGFYGSVYRA-VWRNR-EIALKRI----REGCEDKKIEREIYQLTKASHVNIVELYGT---SR 74
            :|.|.||.||.. .|... ..|||.:    .:...|..:|.. |..:...|..:|:|:|:   ..
Human   658 LGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFH-YMRSLPKHERLVDLHGSVIDYN 721

  Fly    75 HEG----CALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDI 135
            :.|    ..||:||     .|...|:...|...:.......|..:.:||.:||.   :.::||||
Human   722 YGGGSSIAVLLIME-----RLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHS---QGLVHRDI 778

  Fly   136 KPLNTLLCEKGLKLKICDFGTVVDLSQSISCNAGTCRYKAPEVLQGNKPDEKCDVYSWAITFWEI 200
            |..|.|| :|..:.||.|.|.....:.......||..:.|||:..| |.|...|||::.|.||.|
Human   779 KLKNVLL-DKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTG-KYDNSVDVYAFGILFWYI 841

  Fly   201 LSRK----EPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIVALLYASWDPDISKRFSMELIS 261
            .|..    |.||:..:...|:..:..|.||:...:..   .:...|:.|.||.|..||..:.::.
Human   842 CSGSVKLPEAFERCASKDHLWNNVRRGARPERLPVFD---EECWQLMEACWDGDPLKRPLLGIVQ 903

  Fly   262 QSMGRILS 269
            ..:..|::
Human   904 PMLQGIMN 911

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 73/255 (29%)
PKc_like 19..268 CDD:304357 73/265 (28%)
DSTYKNP_056190.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PKc_Dusty 651..912 CDD:270877 74/268 (28%)
S_TKc 653..897 CDD:214567 72/252 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.