DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Ripk3

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_647558.2 Gene:Ripk3 / 246240 RGDID:628899 Length:478 Species:Rattus norvegicus


Alignment Length:276 Identity:81/276 - (29%)
Similarity:126/276 - (45%) Gaps:44/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EEIQTKELIGTGFYGSVYRA---VWRNREIALKRIREGCEDKKIEREIYQLTKASHVNIVELYGT 72
            ||::....:|.|.:|:|:||   .| |.::|:|.:    ..|||.||:..:....|.|::.|.|.
  Rat    20 EELENLGFVGKGGFGAVFRARHTAW-NLDVAVKIV----NSKKISREVKAMVNLRHENVLLLLGV 79

  Fly    73 SRH------EGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNW------AHQIAQGIAYLHGM 125
            :.:      .|.| |:..|::.||||..|    :||....    |      ..::..|:.|||.:
  Rat    80 TENLEWDYVYGPA-LVTGFMENGSLSGLL----QPSCPRP----WPLLCRLLEEVVLGMCYLHSL 135

  Fly   126 QPKAVIHRDIKPLNTLLCEKGLKLKICDFG--TVVDLSQSIS-----CNAGTCRYKAPEVLQGN- 182
            .| :::|||:||.|.|| :..|..|:.|||  |....|||.|     .:.||..|.|||:|..: 
  Rat   136 NP-SLLHRDLKPSNVLL-DPELHAKLADFGLSTFQGGSQSGSGSGSRDSGGTLAYLAPELLDNDG 198

  Fly   183 KPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCP-----ADIVAL 242
            |..:..||||:.:..|.:|:.:|......|........|...||.|:.:....|     ..:..|
  Rat   199 KASKASDVYSFGVLVWTVLAGREAEVVDKTSLIRGAVCNRQRRPPLTELPPDSPETPGLEGLKEL 263

  Fly   243 LYASWDPDISKRFSME 258
            :...|..:...|.|.:
  Rat   264 MTHCWSSEPKDRPSFQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 79/271 (29%)
PKc_like 19..268 CDD:304357 79/268 (29%)
Ripk3NP_647558.2 PKc_like 28..285 CDD:419665 79/268 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..330
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..429
RHIM 408..458 CDD:403811
RIP homotypic interaction motif (RHIM). /evidence=ECO:0000250|UniProtKB:Q9Y572 437..461
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.