DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Mos

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_064487.3 Gene:Mos / 24559 RGDID:3103 Length:342 Species:Rattus norvegicus


Alignment Length:282 Identity:73/282 - (25%)
Similarity:131/282 - (46%) Gaps:51/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGTGFYGSVYRAVWRNREIALKRIREGCEDKKIEREIY----QLTKASHVNIVELYGTSRH--EG 77
            :|:|.:||||:|.:....:|:|::.:...:.:..:..:    .:.:..|.|||.:...|..  ||
  Rat    68 LGSGGFGSVYKATYHGVPVAIKQVNKCTRNLRASQRSFWAELNIARLHHDNIVRVVAASTRTPEG 132

  Fly    78 ---CALLLMEFVDGGSLSSFLH-----AKSKP-------SYSHAHAFNWAHQIAQGIAYLHGMQP 127
               ...::|||  ||:::  ||     |...|       ..|......::..|..|:.:||.   
  Rat   133 SNSLGTIIMEF--GGNVT--LHQVIYGATRSPEPLSCREQLSLGKCLKYSLDIVNGLLFLHS--- 190

  Fly   128 KAVIHRDIKPLNTLLCEKGLKLKICDFGTVVDLSQSISCN-------AGTCRYKAPEVLQGNKPD 185
            ::::|.|:||.|.|:.||.: .||.|||....| |.:.|.       .||..::|||:|:|....
  Rat   191 QSILHLDLKPANILISEKDV-CKISDFGCSQKL-QDLRCRQASLHHIGGTYTHQAPELLKGEIAT 253

  Fly   186 EKCDVYSWAITFWEILSRKEPFE---QYNTLFELYMAINEGERPDL-----SCIMSGCPADIVAL 242
            .|.|:||:.||.|::.:|:.|:.   ||    ..|..:....||.|     :..::|  ..:..:
  Rat   254 PKADIYSFGITLWQMTTREVPYSGEPQY----VQYAVVAYNLRPSLAGAVFTASLTG--KTLQNI 312

  Fly   243 LYASWDPDISKRFSMELISQSM 264
            :.:.|:....:|...||:.:.:
  Rat   313 VQSCWEARALQRPGAELLQKDL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 71/274 (26%)
PKc_like 19..268 CDD:304357 73/282 (26%)
MosNP_064487.3 STKc_Mos 58..329 CDD:270881 71/275 (26%)
S_TKc 64..331 CDD:214567 73/277 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.