Sequence 1: | NP_651090.2 | Gene: | Takl2 / 42692 | FlyBaseID: | FBgn0039015 | Length: | 281 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001363880.1 | Gene: | Ankk1 / 244859 | MGIID: | 3045301 | Length: | 746 | Species: | Mus musculus |
Alignment Length: | 264 | Identity: | 78/264 - (29%) |
---|---|---|---|
Similarity: | 127/264 - (48%) | Gaps: | 42/264 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 LIGTGFYGSVYRA---VWRNR-----EIALKRIREGCEDKKIEREIYQLTKASHVNIVELYGTSR 74
Fly 75 HE-GCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNW------AHQIAQGIAYLHGMQPKAVIH 132
Fly 133 RDIKPLNTLLCEKGLKLKICDFGTVVDLSQSI-------SCNAGTCRYKAPEV-LQGNK-PDEKC 188
Fly 189 DVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADI---VALLYASWDPD 250
Fly 251 ISKR 254 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Takl2 | NP_651090.2 | S_TKc | 14..258 | CDD:214567 | 78/264 (30%) |
PKc_like | 19..268 | CDD:304357 | 77/263 (29%) | ||
Ankk1 | NP_001363880.1 | PKc_like | 37..305 | CDD:389743 | 78/264 (30%) |
PHA02876 | <364..>694 | CDD:165207 | |||
ANK 1 | 370..399 | ||||
ANK repeat | 373..401 | CDD:293786 | |||
ANK repeat | 403..434 | CDD:293786 | |||
ANK 2 | 403..432 | ||||
ANK repeat | 436..467 | CDD:293786 | |||
ANK 3 | 436..465 | ||||
ANK 4 | 469..498 | ||||
ANK repeat | 469..497 | CDD:293786 | |||
ANK repeat | 502..532 | CDD:293786 | |||
ANK 5 | 502..531 | ||||
ANK 6 | 535..564 | ||||
ANK repeat | 537..566 | CDD:293786 | |||
ANK repeat | 568..599 | CDD:293786 | |||
ANK 7 | 568..597 | ||||
ANK 8 | 601..630 | ||||
ANK repeat | 602..632 | CDD:293786 | |||
ANK repeat | 634..665 | CDD:293786 | |||
ANK 9 | 634..663 | ||||
ANK repeat | 667..698 | CDD:293786 | |||
ANK 10 | 667..696 | ||||
Ank_2 | 672..>742 | CDD:372319 | |||
ANK repeat | 700..730 | CDD:293786 | |||
ANK 11 | 700..729 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0192 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |