DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Ankk1

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001363880.1 Gene:Ankk1 / 244859 MGIID:3045301 Length:746 Species:Mus musculus


Alignment Length:264 Identity:78/264 - (29%)
Similarity:127/264 - (48%) Gaps:42/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LIGTGFYGSVYRA---VWRNR-----EIALKRIREGCEDKKIEREIYQLTKASHVNIVELYGTSR 74
            |:.:|.:..|::|   .||.:     ...|::.....|...:..|..::.|....:||.:||..:
Mouse    39 LVASGGFSKVFQARHKRWRTQYAIKCSPCLQKETTSSEVTCLFEEAVKMEKIKFQHIVSIYGVCK 103

  Fly    75 HE-GCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNW------AHQIAQGIAYLHGMQPKAVIH 132
            .. |   ::|||:..|||.     |:.|:    |:..|      .|:.:..:.:||.::| .::|
Mouse   104 QPLG---IVMEFMASGSLE-----KTLPT----HSLCWPLKLRIIHETSLAMNFLHSIKP-PLLH 155

  Fly   133 RDIKPLNTLLCEKGLKLKICDFGTVVDLSQSI-------SCNAGTCRYKAPEV-LQGNK-PDEKC 188
            .|:||.|.|| :..:.:||.|||....:.||.       |...||..|..||: |:.|| |..:.
Mouse   156 LDLKPGNILL-DNNMHVKISDFGLSKWMEQSTQKQYIERSALRGTLSYIPPEMFLENNKAPGPEY 219

  Fly   189 DVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADI---VALLYASWDPD 250
            ||||:||..||||::|:|:...| :..:.:.:..|.||.|..:....|.::   |.|:...||.|
Mouse   220 DVYSFAIVIWEILTQKKPYAGLN-MMTIIIRVAAGMRPSLQDVSDEWPEEVHQMVNLMKRCWDQD 283

  Fly   251 ISKR 254
            ..||
Mouse   284 PKKR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 78/264 (30%)
PKc_like 19..268 CDD:304357 77/263 (29%)
Ankk1NP_001363880.1 PKc_like 37..305 CDD:389743 78/264 (30%)
PHA02876 <364..>694 CDD:165207
ANK 1 370..399
ANK repeat 373..401 CDD:293786
ANK repeat 403..434 CDD:293786
ANK 2 403..432
ANK repeat 436..467 CDD:293786
ANK 3 436..465
ANK 4 469..498
ANK repeat 469..497 CDD:293786
ANK repeat 502..532 CDD:293786
ANK 5 502..531
ANK 6 535..564
ANK repeat 537..566 CDD:293786
ANK repeat 568..599 CDD:293786
ANK 7 568..597
ANK 8 601..630
ANK repeat 602..632 CDD:293786
ANK repeat 634..665 CDD:293786
ANK 9 634..663
ANK repeat 667..698 CDD:293786
ANK 10 667..696
Ank_2 672..>742 CDD:372319
ANK repeat 700..730 CDD:293786
ANK 11 700..729
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.