DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Ripk1

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001346926.1 Gene:Ripk1 / 19766 MGIID:108212 Length:656 Species:Mus musculus


Alignment Length:260 Identity:73/260 - (28%)
Similarity:122/260 - (46%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EIQTKELIGTGFYGSVYRAVWRNRE-IALKRIREGCE----DKKIEREIYQLTKASHVNIVELYG 71
            ::..|..:.:|.:|.|.....|:.. :.||::..|..    ::.:..|...:.:..|..:|:|.|
Mouse    16 DLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTGPNRAEYNEVLLEEGKMMHRLRHSRVVKLLG 80

  Fly    72 TSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIK 136
            ....||...|:||:::.|:|...|  |::.....:.......:..:|:.|||   .|.|||:|:|
Mouse    81 IIIEEGNYSLVMEYMEKGNLMHVL--KTQIDVPLSLKGRIIVEAIEGMCYLH---DKGVIHKDLK 140

  Fly   137 PLNTLLCEKGLKLKICDFGTVV------------DLSQSISC-----NAGTCRYKAPEVLQ--GN 182
            |.| :|.::...:||.|.|...            :..:.:|.     |.||..|.|||.|.  ..
Mouse   141 PEN-ILVDRDFHIKIADLGVASFKTWSKLTKEKDNKQKEVSSTTKKNNGGTLYYMAPEHLNDINA 204

  Fly   183 KPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIVALLYASW 247
            ||.||.||||:.|..|.|.::|||:|......:..:.|..|.||::..|:..||.:|::|:...|
Mouse   205 KPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVICIKSGNRPNVEEILEYCPREIISLMERCW 269

  Fly   248  247
            Mouse   270  269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 73/258 (28%)
PKc_like 19..268 CDD:304357 72/253 (28%)
Ripk1NP_001346926.1 PKc_like 23..291 CDD:419665 72/253 (28%)
Interaction with SQSTM1. /evidence=ECO:0000250|UniProtKB:Q13546 291..567
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..373
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 388..423
RIP homotypic interaction motif (RHIM). /evidence=ECO:0000269|PubMed:18442983, ECO:0000269|PubMed:27819681, ECO:0000269|PubMed:27819682 520..536
Death_RIP1 568..653 CDD:260048
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.