DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and MLKL

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_689862.1 Gene:MLKL / 197259 HGNCID:26617 Length:471 Species:Homo sapiens


Alignment Length:295 Identity:62/295 - (21%)
Similarity:130/295 - (44%) Gaps:48/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VEGVPYE---EIQTKELIGTGF-------YGSVYRAVWRNREIAL---KRIREG---CEDKKIER 53
            ::.:|.|   ||:.::|.|:.:       ..::|:..:....:|:   |:::.|   ...:...:
Human   185 MQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNK 249

  Fly    54 EIYQLTKASHVNIVELYGTSRHEGCA----LLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQ 114
            ||..:.|....||:.::|....|...    .::||:.:.|:|...|..:...:.......  ...
Human   250 EIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKDLTLGKRMVL--VLG 312

  Fly   115 IAQGIAYLHGMQ-PKAVIHRDIKPLNTLLCEKGLKLKICDFGTVVDLSQS-ISCNAGTCR----- 172
            .|:|:..||..: |:  :|..|:..|.|:.: |.::|:..|    :|.:: .|.:.||.|     
Human   313 AARGLYRLHHSEAPE--LHGKIRSSNFLVTQ-GYQVKLAGF----ELRKTQTSMSLGTTREKTDR 370

  Fly   173 -----YKAPEVLQG--NKPDEKCDVYSWAITFWEILSRKEPFEQYNT-LFELYMAINEGERPDLS 229
                 |.:|:.|:.  .:.|.|.::||:.|..|||.:...||:..|: .....:|:...:.|   
Human   371 VKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEP--- 432

  Fly   230 CIMSGCPADIVALLYASWDPDISKRFSMELISQSM 264
             :...||:::..::......|.|.|.|::.|.:.:
Human   433 -LGEDCPSELREIIDECRAHDPSVRPSVDEILKKL 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 57/275 (21%)
PKc_like 19..268 CDD:304357 57/278 (21%)
MLKLNP_689862.1 N-terminal bundle and brace (NBB), mediates INSP6 binding. /evidence=ECO:0000269|PubMed:29883610 1..149
PHA02988 177..469 CDD:165291 62/295 (21%)
PKc_like 215..466 CDD:304357 56/263 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.