DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Y53F4B.1

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_497085.2 Gene:Y53F4B.1 / 190206 WormBaseID:WBGene00013149 Length:463 Species:Caenorhabditis elegans


Alignment Length:234 Identity:62/234 - (26%)
Similarity:99/234 - (42%) Gaps:45/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PVEGVPYEEIQTKEL-----------IGTGFYGSVYRAVWRNREIALKRIREGCEDKK---IERE 54
            |:..|...:|:|.:|           :|.|.|..|:...::..:..|||..:...||:   |.||
 Worm     3 PLSSVELTDIKTDDLDIKWDNVQQFKLGDGSYADVFHVFYKGHDAVLKRSIKEYTDKERENIRRE 67

  Fly    55 IYQLTKASHV-NIVELYGTSRHEGCALLLMEFVDGGSLSS--FLHAKSKPSYSHAHAFNWAHQIA 116
            ...:...::. |:|.:||.........::||:..|.:||.  |...:.|..:.....|.|.|.:.
 Worm    68 ARVVAALNNCENVVRIYGICETLPFRGMIMEYCAGPNLSELVFQLDECKVKFETLRIFKWCHDLT 132

  Fly   117 Q-----GIAYLHG-MQPKAV------------IHRDIKPLNTL--LCE-------KGLKLKICDF 154
            :     .:.|.|| ::.|.|            |:.::|..||.  ||.       :.|.||||||
 Worm   133 RTLCELNVTYYHGDVKAKNVLVKERPCCCVEGIYENVKIRNTTYSLCTICNGVHLEHLSLKICDF 197

  Fly   155 GTVVDLSQSISCNAGTCRYKAPEVLQGNKPDEKCDVYSW 193
            |...:.......|.||..:.|||.::|.. .||.:|||:
 Worm   198 GMSYEHKDKRLYNGGTREFSAPETIRGIY-TEKSEVYSF 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 59/224 (26%)
PKc_like 19..268 CDD:304357 57/208 (27%)
Y53F4B.1NP_497085.2 PKc 29..303 CDD:270622 57/208 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.