DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and Mos

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_064405.2 Gene:Mos / 17451 MGIID:97052 Length:343 Species:Mus musculus


Alignment Length:293 Identity:71/293 - (24%)
Similarity:135/293 - (46%) Gaps:51/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIREGCEDKKIEREIY----QLTKASHVNIVE 68
            :.:|::.....:|:|.:||||:|.:....:|:|::.:..:|.:..:..:    .:.:..|.|||.
Mouse    58 IDWEQVCLMHRLGSGGFGSVYKATYHGVPVAIKQVNKCTKDLRASQRSFWAELNIARLRHDNIVR 122

  Fly    69 LYGTSRH-----EGCALLLMEFVDGGSLSSFLH-----AKSKP-------SYSHAHAFNWAHQIA 116
            :...|..     .....::|||  ||:::  ||     |...|       ..|......::..:.
Mouse   123 VVAASTRTPEDSNSLGTIIMEF--GGNVT--LHQVIYGATRSPEPLSCREQLSLGKCLKYSLDVV 183

  Fly   117 QGIAYLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGTVVDLSQSISCN-------AGTCRYK 174
            .|:.:||.   ::::|.|:||.|.|:.|:.: .||.|||....| |.:.|.       .||..::
Mouse   184 NGLLFLHS---QSILHLDLKPANILISEQDV-CKISDFGCSQKL-QDLRCRQASPHHIGGTYTHQ 243

  Fly   175 APEVLQGNKPDEKCDVYSWAITFWEILSRKEPFE---QYNTLFELYMAINEGERPDL-----SCI 231
            |||:|:|.....|.|:||:.||.|::.:|:.|:.   ||    ..|..:....||.|     :..
Mouse   244 APEILKGEIATPKADIYSFGITLWQMTTREVPYSGEPQY----VQYAVVAYNLRPSLAGAVFTAS 304

  Fly   232 MSGCPADIVALLYASWDPDISKRFSMELISQSM 264
            ::|  ..:..::.:.|:....:|...||:.:.:
Mouse   305 LTG--KTLQNIIQSCWEARALQRPGAELLQRDL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 68/279 (24%)
PKc_like 19..268 CDD:304357 70/282 (25%)
MosNP_064405.2 STKc_Mos 59..335 CDD:270881 71/290 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.