Sequence 1: | NP_651090.2 | Gene: | Takl2 / 42692 | FlyBaseID: | FBgn0039015 | Length: | 281 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_940980.4 | Gene: | LRRK2 / 120892 | HGNCID: | 18618 | Length: | 2527 | Species: | Homo sapiens |
Alignment Length: | 235 | Identity: | 67/235 - (28%) |
---|---|---|---|
Similarity: | 114/235 - (48%) | Gaps: | 31/235 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 EEIQTKE----LIGTGFYGSVYRAVWRNREIALKRIREGCEDKKIEREIYQLTKASHVNIVELYG 71
Fly 72 TSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIK 136
Fly 137 PLNTLLC----EKGLKLKICDFGTVVDLSQ-----SISCNAGTCRYKAPEVLQGNK-PDEKCDVY 191
Fly 192 SWAITFWEILSR----KEPFEQYNTLFELYMAINEGERPD 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Takl2 | NP_651090.2 | S_TKc | 14..258 | CDD:214567 | 66/232 (28%) |
PKc_like | 19..268 | CDD:304357 | 65/223 (29%) | ||
LRRK2 | NP_940980.4 | Required for RAB29-mediated activation. /evidence=ECO:0000269|PubMed:29212815 | 1..969 | ||
LRR 1 | 983..1004 | ||||
leucine-rich repeat | 985..1012 | CDD:275380 | |||
LRR | 1012..>1286 | CDD:227223 | |||
LRR 2 | 1012..1033 | ||||
leucine-rich repeat | 1013..1036 | CDD:275380 | |||
LRR 3 | 1036..1057 | ||||
leucine-rich repeat | 1037..1084 | CDD:275380 | |||
LRR 4 | 1059..1080 | ||||
LRR 5 | 1084..1105 | ||||
leucine-rich repeat | 1085..1108 | CDD:275380 | |||
LRR 6 | 1108..1129 | ||||
leucine-rich repeat | 1109..1130 | CDD:275380 | |||
LRR 7 | 1130..1150 | ||||
leucine-rich repeat | 1131..1174 | CDD:275380 | |||
LRR 8 | 1174..1196 | ||||
leucine-rich repeat | 1175..1197 | CDD:275380 | |||
LRR 9 | 1197..1218 | ||||
leucine-rich repeat | 1198..1221 | CDD:275380 | |||
LRR 10 | 1221..1241 | ||||
leucine-rich repeat | 1222..1246 | CDD:275380 | |||
LRR 11 | 1246..1267 | ||||
leucine-rich repeat | 1247..1269 | CDD:275380 | |||
LRR 12 | 1269..1291 | ||||
RocCOR | 1334..1507 | CDD:206741 | |||
COR | 1527..1740 | CDD:318343 | |||
STKc_LRRK2 | 1884..2135 | CDD:270970 | 66/224 (29%) | ||
WD 1 | 2139..2183 | ||||
WD 2 | 2188..2228 | ||||
WD 3 | 2233..2276 | ||||
WD 4 | 2281..2327 | ||||
WD 5 | 2333..2377 | ||||
WD 6 | 2402..2438 | ||||
WD 7 | 2443..2497 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0192 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |