DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl2 and ripk3

DIOPT Version :9

Sequence 1:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_001343827.1 Gene:ripk3 / 100004555 ZFINID:ZDB-GENE-071115-4 Length:433 Species:Danio rerio


Alignment Length:267 Identity:80/267 - (29%)
Similarity:132/267 - (49%) Gaps:44/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGTGFYGSVYRA---VWRNREIALKRI--REGCEDKKIEREIYQLTKASHVNIVELYGTSRHEG- 77
            :|:|.:|.::||   :| ..::|:|.:  :|| .....:||...:..|.:.|:|.:.|.  :|| 
Zfish    24 VGSGGFGQIFRARHTLW-GTDVAVKLLHYKEG-SASSAQREAELMFDAGNSNVVRVLGV--YEGR 84

  Fly    78 ---------CALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHR 133
                     |.|:| ||:..|||...|...:.|. ..|.|...|.|::.|:.:||.:.| .::|.
Zfish    85 LGDPQRPLQCGLVL-EFLARGSLEDLLQRLAAPP-PCALALRMALQVSLGMNFLHQLTP-PILHL 146

  Fly   134 DIKPLNTLLCEKGLKLKICDFGTVVDLSQSISC---------NAGTCRYKAPEVLQGN--KPDEK 187
            |:||.|.||.: .|..||.||| :..::::: |         ..||..|..||.||.:  ||.:.
Zfish   147 DLKPSNVLLSD-SLDAKITDFG-LSRVAENV-CKYTGVNDEDEGGTLSYMPPEALQSSSYKPSKA 208

  Fly   188 CDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPA-----DIVALLYASW 247
            .||||:.|..|.|::.|||:....:.. :...|..|:||||:.:  .|..     :::.|:...|
Zfish   209 FDVYSYGILLWSIITGKEPYSGVQSSL-VRFRIPLGDRPDLASV--DCSETEGLDELLKLMMQCW 270

  Fly   248 DPDISKR 254
            |.:..:|
Zfish   271 DQEPHRR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 80/267 (30%)
PKc_like 19..268 CDD:304357 80/267 (30%)
ripk3XP_001343827.1 TyrKc 20..287 CDD:197581 80/267 (30%)
PKc_like 24..285 CDD:304357 80/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.