DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45049 and Cldnd2

DIOPT Version :9

Sequence 1:NP_001287471.1 Gene:CG45049 / 42691 FlyBaseID:FBgn0266409 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_017167838.1 Gene:Cldnd2 / 74276 MGIID:1921526 Length:200 Species:Mus musculus


Alignment Length:117 Identity:27/117 - (23%)
Similarity:46/117 - (39%) Gaps:36/117 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 YWTRDVG--------------------YIKATAALCIITLITDVIATVLTGLGLRTQNHNLKYKF 188
            ||||..|                    ...|.:|.|::...|  .:.|..|:|:|.|....:.:.
Mouse    30 YWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAAT--FSIVALGIGIRIQCREAESRR 92

  Fly   189 YRIAVLVMLVSLLAVLSALIVYPVCFAGELTMANRRVWE----FGWAYGVGW 236
            .:..::::.:|.|.:|.||.||          .::..|:    |.|:|..||
Mouse    93 SQNTIVLLFLSGLLLLIALAVY----------TSKNAWKPEVFFSWSYFFGW 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45049NP_001287471.1 PMP22_Claudin <150..249 CDD:304458 23/111 (21%)
Cldnd2XP_017167838.1 PMP22_Claudin 23..140 CDD:389833 27/117 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.