DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45049 and Perp

DIOPT Version :9

Sequence 1:NP_001287471.1 Gene:CG45049 / 42691 FlyBaseID:FBgn0266409 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_071315.1 Gene:Perp / 64058 MGIID:1929938 Length:193 Species:Mus musculus


Alignment Length:180 Identity:45/180 - (25%)
Similarity:71/180 - (39%) Gaps:36/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PLKVIAFICGVIVVALMIMALASTDWLMASDWRQ--GLFVHCIE--------DDSVPPLPFNIQD 139
            ||.:::      .:|..|:|||...||.:|:..|  .|:..|.:        ||           
Mouse    16 PLLLLS------AIAFDIIALAGRGWLQSSNHIQTSSLWWRCFDEGGGSGSYDD----------- 63

  Fly   140 PPGCYWTRDVGYIKATAALCIITLITDVIATVLTGLGLRTQNHNLKYKFYR-IAVLVMLVSLLAV 203
              ||....:..:.:|.||......|...|..:|:...|....   ...|.| |..|:.|.::..:
Mouse    64 --GCQSLMEYAWGRAAAATLFCGFIILCICFILSFFALCGPQ---MLVFLRVIGGLLALAAIFQI 123

  Fly   204 LSALIVYPVCFAGELTMANRRV--WEFGWAYGVGWGAAIFLFGAVVLLLC 251
            :| |::|||.:.....:.:...  :.:.||||.||.|.|.|.|......|
Mouse   124 IS-LVIYPVKYTQTFRLHDNPAVNYIYNWAYGFGWAATIILIGCSFFFCC 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45049NP_001287471.1 PMP22_Claudin <150..249 CDD:304458 27/101 (27%)
PerpNP_071315.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839385
Domainoid 1 1.000 47 1.000 Domainoid score I11967
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14399
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.