DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45049 and Tmem47

DIOPT Version :9

Sequence 1:NP_001287471.1 Gene:CG45049 / 42691 FlyBaseID:FBgn0266409 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001102787.1 Gene:Tmem47 / 501569 RGDID:1564799 Length:181 Species:Rattus norvegicus


Alignment Length:186 Identity:49/186 - (26%)
Similarity:90/186 - (48%) Gaps:22/186 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ITITRPLKVIAFICGVIVVALMIMALASTDWLMAS-DWRQGLFVHCIEDDSVPPLPFNIQDPPGC 143
            :::..|||::..:|..:.:.|.:.|:.|..|:.|. .:...|:..|.:       |.|: |...|
  Rat    13 VSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVTADHQYYLSLWESCRK-------PANL-DSWHC 69

  Fly   144 YWTRDVGYIKATAALCI----ITLITDVIATVLTGLGLRTQNHNLKYKFYRIAVLVMLVSLLAVL 204
            ..|....:..||.||.:    |.||..::..:...:|.|.       :|||...:::..:::..:
  Rat    70 ESTLGSDWQIATLALLLGGAAIILIAFLVGLISICVGSRR-------RFYRPVAVMLFAAVVLQV 127

  Fly   205 SALIVYPVCFAGELTMANRRVWEFGWAYGVGWGAAIFLFGAVVLLLCDKESEEIYY 260
            .:|::||:.|..  |::.:...||.|.||:.|||.||.||..:|...:.::.|.||
  Rat   128 CSLVLYPIKFIE--TVSLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDYY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45049NP_001287471.1 PMP22_Claudin <150..249 CDD:304458 29/102 (28%)
Tmem47NP_001102787.1 PMP22_Claudin 21..170 CDD:419754 42/165 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343202
Domainoid 1 1.000 48 1.000 Domainoid score I11606
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5245
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1307601at2759
OrthoFinder 1 1.000 - - FOG0007301
OrthoInspector 1 1.000 - - oto97872
orthoMCL 1 0.900 - - OOG6_107190
Panther 1 1.100 - - O PTHR14399
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5405
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.