DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45049 and NKG7

DIOPT Version :9

Sequence 1:NP_001287471.1 Gene:CG45049 / 42691 FlyBaseID:FBgn0266409 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_005592.1 Gene:NKG7 / 4818 HGNCID:7830 Length:165 Species:Homo sapiens


Alignment Length:134 Identity:35/134 - (26%)
Similarity:48/134 - (35%) Gaps:48/134 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 CIITLITD-----VIATVLTGLGLRTQNH--------NLKYKFYRIAVLVMLVSL-LAVLSA--- 206
            |:|.|.||     |..|.....||....|        ::...|..:|||..|||: ..|||.   
Human    19 CLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQTFSIMAVLWALVSVSFLVLSCFPS 83

  Fly   207 --------LIVYPVCFAGELTMA------NRRVWE----------FGWAYGVGWGAAIFLFGAVV 247
                    |:.....||..::|.      ....|:          |.|::.:||.:||       
Human    84 LFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQPPHPQIQTFFSWSFYLGWVSAI------- 141

  Fly   248 LLLC 251
            ||||
Human   142 LLLC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45049NP_001287471.1 PMP22_Claudin <150..249 CDD:304458 31/130 (24%)
NKG7NP_005592.1 PMP22_Claudin 21..149 CDD:328820 34/132 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.