DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45049 and lim2.3

DIOPT Version :9

Sequence 1:NP_001287471.1 Gene:CG45049 / 42691 FlyBaseID:FBgn0266409 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001002587.1 Gene:lim2.3 / 436860 ZFINID:ZDB-GENE-040718-327 Length:172 Species:Danio rerio


Alignment Length:174 Identity:38/174 - (21%)
Similarity:70/174 - (40%) Gaps:40/174 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CGVIVVALMIMALASTDWLM----ASDWRQGLFVHCI------EDDSVPPLPFNIQDPPGCYWTR 147
            |..:...|::::.|:..|:.    :|...|||:.:|:      ..||:            .||..
Zfish    11 CAGVGNILLVISTATDYWMQYRQSSSYMHQGLWRYCVPGKCMTHTDSI------------AYWDA 63

  Fly   148 DVGYIKATAALCIITLITDVIATVLTGLGLRTQNHNLKYKFYR--IAVLVMLVSLLAVLSALIVY 210
            ...::......|...:|..|:|.:         |::....|.|  .|.::..:|...||.|:.||
Zfish    64 TRAFMILATLACFFGMIIGVMAFI---------NYSSFTGFDRTFAAGILYFISCFFVLLAMAVY 119

  Fly   211 ---PVCFAGELTMANRRVWEFGWAYGVGWGAAIFLFGAVVLLLC 251
               .|.:.|: ...|   |.|.|:|.:||.:.:..|.:.:..:|
Zfish   120 TGMTVNYYGK-RYGN---WRFSWSYIMGWVSVVLTFFSGIFYMC 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45049NP_001287471.1 PMP22_Claudin <150..249 CDD:304458 24/103 (23%)
lim2.3NP_001002587.1 PMP22_Claudin 1..157 CDD:304458 37/170 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1307601at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.