DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45049 and TMEM202

DIOPT Version :9

Sequence 1:NP_001287471.1 Gene:CG45049 / 42691 FlyBaseID:FBgn0266409 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001073931.1 Gene:TMEM202 / 338949 HGNCID:33733 Length:273 Species:Homo sapiens


Alignment Length:258 Identity:55/258 - (21%)
Similarity:97/258 - (37%) Gaps:94/258 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ESVTLDYYKESV---------LRP--PAEKMAPTTTIETITITRPLKV-------IAFICGVI-- 96
            |.:||.::...|         .||  ||:| .|:.   :::..|..::       |..:||.:  
Human     5 EHLTLTFHSPEVPKIKGNRKYQRPTVPAKK-HPSA---SMSCQRQQQLMDQAHIYIRTLCGSLCS 65

  Fly    97 VVALMIMALASTDWLMASDWRQGLFVH-----------CIEDDSVPPLPFNIQDPPGCYWTRDVG 150
            ...||::|::..:|:.....:.||.::           |......||.                 
Human    66 FSLLMLIAMSPLNWVQFLVIKNGLELYAGLWTLCNHELCWSHTPKPPY----------------- 113

  Fly   151 YIKATAALCIITLITDVIATVLTGL-----------GLRTQNHNLKYKFYRIAVLVMLVSLLAVL 204
            |::.:.|..:|:     :.|:||||           |..|.|.:||            ||:|:.:
Human   114 YLQYSRAFFLIS-----VFTILTGLGWLFSSWILNRGSMTTNLDLK------------VSMLSFI 161

  Fly   205 SA--LIVYPVCFAGELTMANRRVWEFG--WAYGVGWGAAIF-LFGAVVLLL---------CDK 253
            ||  |::....|..::....|...|..  |.|.:.|.:.|| :|..::.||         ||:
Human   162 SATCLLLCLNLFVAQVHWHTRDAMESDLLWTYYLNWCSDIFYMFAGIISLLNYLTSRSPACDE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45049NP_001287471.1 PMP22_Claudin <150..249 CDD:304458 28/114 (25%)
TMEM202NP_001073931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.