DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45049 and Perp

DIOPT Version :9

Sequence 1:NP_001287471.1 Gene:CG45049 / 42691 FlyBaseID:FBgn0266409 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001099735.1 Gene:Perp / 292949 RGDID:1310294 Length:193 Species:Rattus norvegicus


Alignment Length:180 Identity:45/180 - (25%)
Similarity:72/180 - (40%) Gaps:36/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PLKVIAFICGVIVVALMIMALASTDWLMASDWRQ--GLFVHCIE--------DDSVPPLPFNIQD 139
            ||.:::      .:|..|:||:...||.:|:..|  .|:..|.:        ||           
  Rat    16 PLLLLS------AIAFDIIALSGRGWLQSSNHIQTSSLWWRCFDEGGGSGSYDD----------- 63

  Fly   140 PPGCYWTRDVGYIKATAALCIITLITDVIATVLTGLGLRTQNHNLKYKFYR-IAVLVMLVSLLAV 203
              ||....:..:.:|.||......|..||..:|:...|....   ...|.| |..|:.|.::..:
  Rat    64 --GCQSLMEYAWGRAAAATLFCGFIILVICFILSFFALCGPQ---MLVFLRVIGGLLALAAVFQI 123

  Fly   204 LSALIVYPVCFAGELTMANRRV--WEFGWAYGVGWGAAIFLFGAVVLLLC 251
            :| |::|||.:.....:.:...  :.:.||||.||.|.|.|.|......|
  Rat   124 IS-LVIYPVKYTQTFRLHDNPAVNYIYNWAYGFGWAATIILIGCSFFFCC 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45049NP_001287471.1 PMP22_Claudin <150..249 CDD:304458 28/101 (28%)
PerpNP_001099735.1 PMP22_Claudin 35..164 CDD:419754 36/145 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343201
Domainoid 1 1.000 48 1.000 Domainoid score I11606
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5245
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1307601at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14399
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.