DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45049 and EMP1

DIOPT Version :9

Sequence 1:NP_001287471.1 Gene:CG45049 / 42691 FlyBaseID:FBgn0266409 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_024304645.1 Gene:EMP1 / 2012 HGNCID:3333 Length:192 Species:Homo sapiens


Alignment Length:202 Identity:51/202 - (25%)
Similarity:81/202 - (40%) Gaps:46/202 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VIAFICGVIVV--ALMIMALAST---DWLMAS--DWRQGLFVHC---------------IEDDSV 130
            ::..:.|:.||  |.:||...||   .||:::  |...||:.:|               |..|..
Human     1 MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEGIYKDID 65

  Fly   131 PPLPFNIQ---DPPG-----CYWTRDVG--YIKATAALCIITLITDVIATVLTGLGLRTQNHNLK 185
            |.|...:.   ..||     |. .|.|.  .:|...|..|:::|..|||.::....|.|..   |
Human    66 PVLTIGVVRECSAPGVTSCPCS-PRPVSTDALKTVQAFMILSIIFCVIALLVFVFQLFTME---K 126

  Fly   186 YKFYRIAVLVMLVSLLAVLSALIVYPVCFAGELTMANR--RVWEFGWAYGVGWGAAIFLF--GAV 246
            ...:.::....||..|.:|..:.:|...:      |||  ..:..|::|.:||....|.|  |.:
Human   127 GNRFFLSGATTLVCWLCILVGVSIYTSHY------ANRDGTQYHHGYSYILGWICFCFSFIIGVL 185

  Fly   247 VLLLCDK 253
            .|:|..|
Human   186 YLVLRKK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG45049NP_001287471.1 PMP22_Claudin <150..249 CDD:304458 25/104 (24%)
EMP1XP_024304645.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.