DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF220 and rnf4

DIOPT Version :10

Sequence 1:NP_651088.1 Gene:RNF220 / 42690 FlyBaseID:FBgn0039013 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001016554.1 Gene:rnf4 / 549308 XenbaseID:XB-GENE-1016982 Length:188 Species:Xenopus tropicalis


Alignment Length:181 Identity:38/181 - (20%)
Similarity:56/181 - (30%) Gaps:62/181 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 GPKPNHSSEATEQEPASTSNVEAPP----------------ASEEP------------------- 309
            |.:|.||..:..:.|.||:.:.|..                .|.||                   
 Frog     8 GAEPGHSKSSKRRAPGSTAAMTAATEPIELESGEEVVDLTCESTEPVVVDLTNNDLSINDSVVIV 72

  Fly   310 -STSRSTRSTSQNQQQ----IIES----------------LKAKLRLYEKQAQGKYKCLICIDDY 353
             .|.|..|:.|:..||    ::.|                :.::.....:.:.||..|.||:|.|
 Frog    73 EDTPRQRRALSRPSQQTTSCVLSSDDEDSRHADHFAANKDISSQAYGSSRSSSGKVSCPICMDSY 137

  Fly   354 KNPA------ISVSCWHVHCEQCWLQTLGARKLCPQCNSITTPKDLRRIYL 398
            ....      :|..|.|:.|.||....|.....||.|......|....||:
 Frog   138 SEIVQSGRLIVSTKCGHIFCSQCLRDALKNAPSCPTCRKKLNHKQYHPIYV 188

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity