DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Irp-1A and AT5G54950

DIOPT Version :9

Sequence 1:	NP_477371.1	Gene:	Irp-1A / 42689	FlyBaseID:	FBgn0024958	Length:	902	Species:	Drosophila melanogaster
Sequence 2:	NP_200306.1	Gene:	AT5G54950 / 835586	AraportID:	AT5G54950	Length:	74	Species:	Arabidopsis thaliana

Alignment Length:	57	Identity:	27/57 - (47%)
Similarity:	34/57 - (59%)	Gaps:	3/57 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   829 LQFLPGQSADTLKLSGREVYNIVLPE--GELKPGQRIQVDAD-GNVFETTLRFDTEV 882
            :.|..|:.|:||.|:|.|:|.|.||.  .|:||||.|.|..| ...|..|||.|||:
plant     1 MAFKSGEDAETLGLTGHELYTIHLPSNINEIKPGQDITVTTDTAKSFVCTLRLDTEI 57

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Irp-1A	NP_477371.1	PTZ00092	1..901	CDD:240263	27/57 (47%)
		AcnA_IRP	88..579	CDD:153136
		AcnA_IRP_Swivel	683..852	CDD:238812	10/22 (45%)
AT5G54950	NP_200306.1	Aconitase_swivel	<3..22	CDD:294147	9/18 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	71	1.000	Domainoid score	I3348
eggNOG	1	0.900	-	-		E1_COG1048
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D190960at2759
OrthoFinder	1	1.000	-	-		FOG0001444
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	5	4.820