DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wge and AT4G23120

DIOPT Version :10

Sequence 1:NP_732790.3 Gene:wge / 42687 FlyBaseID:FBgn0051151 Length:1669 Species:Drosophila melanogaster
Sequence 2:NP_194043.1 Gene:AT4G23120 / 828411 AraportID:AT4G23120 Length:360 Species:Arabidopsis thaliana


Alignment Length:145 Identity:40/145 - (27%)
Similarity:61/145 - (42%) Gaps:26/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1496 GTAYRKAGVKGRARKQFYKTIKRGKETITVGDSAVFLSTGRPDRPYIGRIESMW-ETTTGNKVVR 1559
            |.:::..| ||..:|..|||.:.......:.|| |.|.....::||:..|:.:: :...|:..:.
plant    33 GLSHKCTG-KGEKKKCHYKTFQFHANKYGLEDS-VLLVPEDGEKPYVAIIKDIYTQRKEGHVKLE 95

  Fly  1560 VAWFYHPEET----TGCPKLKFPGALFESPHEDENDVQTISHRCEVLQFGSYFEKFGADSKQ--- 1617
            |.|.|.|||.    .|..|.|....||.|.|.||...:::...|.|        .|..::||   
plant    96 VQWLYRPEEVEKKYVGNWKSKGSRDLFYSFHRDEVFAESVKDDCIV--------HFVQENKQIPN 152

  Fly  1618 --------YQSIYDN 1624
                    .|.:|||
plant   153 RRKHPGFIVQHVYDN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgeNP_732790.3 PHA03247 <484..811 CDD:223021
Tudor_BAHCC1-like 1189..1265 CDD:410468
BAH_BAHCC1 1520..1642 CDD:240065 32/121 (26%)
AT4G23120NP_194043.1 BAH_plant_3 39..185 CDD:240064 39/139 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.