DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4907 and ENPP5

DIOPT Version :9

Sequence 1:NP_651086.1 Gene:CG4907 / 42686 FlyBaseID:FBgn0039010 Length:919 Species:Drosophila melanogaster
Sequence 2:NP_001277001.1 Gene:ENPP5 / 59084 HGNCID:13717 Length:477 Species:Homo sapiens


Alignment Length:286 Identity:53/286 - (18%)
Similarity:102/286 - (35%) Gaps:91/286 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLGSILSIYFQSTILSDLEPLSTLRELGLEPPADRLVVFVVDGLRAQSVLADHCSAVPDLRELF 76
            ||:..||:....||..|            |:|...::::...||.|     .|:...||.....:
Human     6 LLVSFILAALSLSTTFS------------LQPDQQKVLLVSFDGFR-----WDYLYKVPTPHFHY 53

  Fly    77 VEQALVGISRACPPTVTR--PGHIAIFGGF---NEDPAATLTWNP-----------STFDSVF-- 123
            :.:..|.:.:.....:|:  |.|..:..|.   |....|...::|           :.:||.|  
Human    54 IMKYGVHVKQVTNVFITKTYPNHYTLVTGLFAENHGIVANDMFDPIRNKSFSLDHMNIYDSKFWE 118

  Fly   124 ------------NRSRNAIGWMQAEVAKVFTHLPTGGAP----LRFETFARSDISDRL-RLDQWT 171
                        ..:..|..|...:| |:....||...|    :.||        ||: ::.:|.
Human   119 EATPIWITNQRAGHTSGAAMWPGTDV-KIHKRFPTHYMPYNESVSFE--------DRVAKIIEWF 174

  Fly   172 FDKVRNFMTNEQNVQPLRDATSVIFFVYLADIDLAEHVHMPNS-------LNFREKLNYTQRGIR 229
            ..|           :|:.     :..:|..|.|...|...|:|       .:..:||.|..:.::
Human   175 TSK-----------EPIN-----LGLLYWEDPDDMGHHLGPDSPLMGPVISDIDKKLGYLIQMLK 223

  Fly   230 QTYELFESVFNDSRTAYLMTADYGIS 255
            :. :|:.::      ..::|:|:|::
Human   224 KA-KLWNTL------NLIITSDHGMT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4907NP_651086.1 GPI_EPT_1 42..327 CDD:293744 45/256 (18%)
PigN 413..858 CDD:282796
ENPP5NP_001277001.1 Phosphodiest 30..342 CDD:307681 44/250 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.