DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4907 and enpp5

DIOPT Version :9

Sequence 1:NP_651086.1 Gene:CG4907 / 42686 FlyBaseID:FBgn0039010 Length:919 Species:Drosophila melanogaster
Sequence 2:XP_005160520.3 Gene:enpp5 / 563498 ZFINID:ZDB-GENE-041014-10 Length:512 Species:Danio rerio


Alignment Length:433 Identity:90/433 - (20%)
Similarity:133/433 - (30%) Gaps:151/433 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SILSIYFQSTILSDLEPLSTLRELGLEPPADRLVVFVVDGLRAQSVLADHCSAV--PDLRELFVE 78
            |::...|.|.:|:.|:...:.:|     ..::|::...||.|     .|:.:.|  |:...|..|
Zfish    44 SVIRSCFLSCLLALLQTSGSQQE-----EQNQLLLVSFDGFR-----WDYINRVPTPNFHALMDE 98

  Fly    79 QALVGISRACPPTVTRPGHIAIFGGFNEDPAATLTWNPSTFDSVFNRSRNAIG--------WMQA 135
            ..||........|.|.|.|..:..|.:.:....:.  ...:|.:.|||.:..|        |.:|
Zfish    99 GVLVEKVENTYITKTYPNHYTLVTGLHAESHGVVA--NEMYDPIHNRSFSIEGPEVYDAWWWEEA 161

  Fly   136 E------------------------VAKVF-THLPTGGAPLRFETFARSDISDRLRLDQWTFDKV 175
            |                        :...| ||.....|.:.|||..:.      .:|.::..:.
Zfish   162 EPLWVTNQKAGRKSGAAMWPGSDVAIGGTFPTHYLRYNASMLFETRVQK------LIDWFSGPEA 220

  Fly   176 RNFMT--------NEQNVQPLRDATSVIFFVYLADIDLAEHVHMPNSLNF-REKL---------- 221
            .||..        :..|:.|    .|.:..|.|||||        ..|.| ||||          
Zfish   221 INFGVLYWEEPDESGHNLGP----ESPLMDVVLADID--------EKLGFLREKLKSAGLYDKVN 273

  Fly   222 -------NYTQRGIRQTYELFESVFNDSRTAYLMTADYGISLHGGGGE----------------R 263
                   ..||....:..||...|..|..|....:...||....|..|                :
Zfish   274 LIVTSDHGMTQLSHDKIIELDTYVSRDLYTWIDKSPVVGILPKEGKLEEVYGLLKNANPNMVVYK 338

  Fly   264 GVETP-------------------------------FILWGAGVKRSAPNPGQNFTAGENGPIL- 296
            ..|.|                               |:|...|...|.||....|.|  .||.. 
Zfish   339 KEEIPDHYHYRHNARIMPLIIEVKEGWTVMQNRNGSFMLGNHGYNNSLPNMHPVFVA--RGPAFR 401

  Fly   297 ---PLYQLEQIQLAPLMSALIGLPPPMNNMALMPLGFLNTSVQ 336
               ....:..:.|.|||.:::.|.|..||.:|       :|||
Zfish   402 RDYTKTSMRSVDLYPLMCSILALKPLPNNGSL-------SSVQ 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4907NP_651086.1 GPI_EPT_1 42..327 CDD:293744 81/396 (20%)
PigN 413..858 CDD:282796
enpp5XP_005160520.3 Enpp 71..422 CDD:293742 76/377 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.