DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4907 and Enpp3

DIOPT Version :9

Sequence 1:NP_651086.1 Gene:CG4907 / 42686 FlyBaseID:FBgn0039010 Length:919 Species:Drosophila melanogaster
Sequence 2:NP_062243.2 Gene:Enpp3 / 54410 RGDID:708511 Length:875 Species:Rattus norvegicus


Alignment Length:620 Identity:109/620 - (17%)
Similarity:191/620 - (30%) Gaps:249/620 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EPPADRLVVFVVDGLRAQSVLADHCSAVPDLRELFVEQALVGISRACPPTVTRPGHIAIFGGF-- 104
            :||   :::|.:||.||: .|....:.:|::.:|..........||..||.|.|.|..|..|.  
  Rat   159 QPP---VILFSMDGFRAE-YLQTWSTLLPNINKLKTCGLHSKYMRAMYPTKTFPNHYTIVTGLYP 219

  Fly   105 -------------------------NEDP------------------AATLTWNPS------TFD 120
                                     ..:|                  ||:..|..|      :|.
  Rat   220 ESHGIIDNNMYDVYLNKNFSLSSVEKSNPAWWSGQPIWLTAMYQGLKAASYYWPGSDVAVNGSFP 284

  Fly   121 SVFNRSRNAIGWMQAEVAKV--FTHLPTGGAPLRFETFARSD----------------------- 160
            :::....|::.: ::.:|.:  :..||....|..:..:....                       
  Rat   285 NIYRNYSNSVPY-ESRIATLLQWLDLPKAERPSFYTIYVEEPDSAGHKSGPVSAGVIKALQLVDD 348

  Fly   161 ----ISDRLR-----------------LDQWTFDKV----------------------------R 176
                :.:.|:                 :||.:.|:|                            :
  Rat   349 AFGMLMEGLKQRNLHNCVNIIVLADHGMDQTSCDRVEYMTDYFPEINFYMYQGPAPRIRTRNIPQ 413

  Fly   177 NFMT--NEQNVQPLRDATSVIFFVYLADIDLAEHVHMPNSLNF--------REKLNYTQRGIRQT 231
            :|.|  :|:.|:.|....|...|......||.:.:|...::..        |:.|.|..:|    
  Rat   414 DFFTFNSEEIVRDLSCRKSDQHFKPYLTPDLPKRLHYAKNVRIDKVHLMVDRQWLAYRNKG---- 474

  Fly   232 YELFESVFNDSRTAYLMTADYGISLHGGGGE-RGVETPFILWGAGVK------------------ 277
                             :::.....||...| :.:|..|:..|...|                  
  Rat   475 -----------------SSNCEGGTHGYNNEFKSMEAIFLAHGPSFKEKTVIEPFENIEVYNLLC 522

  Fly   278 -----RSAPNPGQNFTAGENGPIL--PLYQ---LEQIQLAPLMSALIGL--PPPMNNMALMPLGF 330
                 :.|||.|.:   |....:|  |.||   .|::.    .||..|.  |.|.:::....|. 
  Rat   523 DLLHIQPAPNNGSH---GSLNHLLKAPFYQPSHAEELS----KSAGCGFTTPLPKDSLNCSCLA- 579

  Fly   331 LNTSVQYEL--QVLHLNAMQLLA---------QARILIKRHEDGILYLLLPKFESLGSAEIENYP 384
            |.||.|.|.  |.|:|:..::.|         :.|::.|..:..:||  ..::.| |..:....|
  Rat   580 LQTSGQEEQVNQRLNLSGGEVSATEKTNLPFGRPRVIQKNKDHCLLY--HREYVS-GFGKAMKMP 641

  Fly   385 QIIKYLVAK--------EQYEEALKVSHKI-AKLAQECMEYY------HGYYHLPLLV------- 427
            ....|.|.|        ....:.|:...:: ...:|:|..|.      ||:.:.|.:.       
  Rat   642 MWSSYTVPKPGDTSSLPPTVPDCLRADVRVDPSESQKCSFYLADQNIDHGFLYPPAIKGNNESQY 706

  Fly   428 -ATTASYLV---------WFY---LLLVRLARESN 449
             |...|.||         |.|   :||::.|.|.|
  Rat   707 DALITSNLVPMYKEFKKMWDYFHKVLLIKYAIERN 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4907NP_651086.1 GPI_EPT_1 42..327 CDD:293744 71/450 (16%)
PigN 413..858 CDD:282796 16/63 (25%)
Enpp3NP_062243.2 SO 51..94 CDD:197571
Cell attachment site. /evidence=ECO:0000255 79..81
SO 95..138 CDD:197571
Phosphodiesterase 141..510 56/376 (15%)
Phosphodiest 162..486 CDD:396300 49/346 (14%)
Nuclease 605..875 28/140 (20%)
NUC 608..867 CDD:238043 28/137 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.