DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4907 and ENPP2

DIOPT Version :9

Sequence 1:NP_651086.1 Gene:CG4907 / 42686 FlyBaseID:FBgn0039010 Length:919 Species:Drosophila melanogaster
Sequence 2:XP_006716647.1 Gene:ENPP2 / 5168 HGNCID:3357 Length:940 Species:Homo sapiens


Alignment Length:121 Identity:30/121 - (24%)
Similarity:47/121 - (38%) Gaps:32/121 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LEPPADRLVVFVVDGLRAQSVLADHCSAVPDLRELFVEQALVGISRACP----------PTVTRP 95
            :.||   |::|.|||.|| |.:......:|::.:|          |:|.          ||.|.|
Human   162 VRPP---LIIFSVDGFRA-SYMKKGSKVMPNIEKL----------RSCGTHSPYMRPVYPTKTFP 212

  Fly    96 GHIAIFGGFNEDPAATLTWNPSTFDSVFNRSRNAIGWMQAEVAKVFTHLPTGGAPL 151
            ....:..|...:....:  ..|.:|.||:.:.:..|      .:.|.|...||.||
Human   213 NLYTLATGLYPESHGIV--GNSMYDPVFDATFHLRG------REKFNHRWWGGQPL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4907NP_651086.1 GPI_EPT_1 42..327 CDD:293744 30/120 (25%)
PigN 413..858 CDD:282796
ENPP2XP_006716647.1 SO 55..98 CDD:197571
SO 99..142 CDD:197571
Enpp 164..570 CDD:293742 30/119 (25%)
Phosphodiest 166..530 CDD:279931 28/114 (25%)
NUC 692..922 CDD:214683
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.