DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4907 and Enpp5

DIOPT Version :9

Sequence 1:NP_651086.1 Gene:CG4907 / 42686 FlyBaseID:FBgn0039010 Length:919 Species:Drosophila melanogaster
Sequence 2:NP_001012762.1 Gene:Enpp5 / 316249 RGDID:1359199 Length:477 Species:Rattus norvegicus


Alignment Length:522 Identity:105/522 - (20%)
Similarity:177/522 - (33%) Gaps:191/522 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LGLEPPADRLVVFVVDGLRAQSVLADHCSAVPDLRELFVEQALVGISRACPPTVTR--PGHIAIF 101
            |.|:....:::|...||.|     .|:...||.....:|.:..|.:.:.....:|:  |.|..:.
  Rat    21 LSLQTEQQKVLVVSFDGFR-----WDYLYKVPTPHFHYVMKNGVHVKQVTNVFITKTYPNHYTLV 80

  Fly   102 GG-FNE----------DPAATLTW---NPSTFDSVF-----------NRSRNAIG---WMQAEVA 138
            .| |.|          ||....::   :.:.:||.|           .|:.:|.|   |...:| 
  Rat    81 TGLFAENHGIVANDMFDPVLNKSFSLEHMNIYDSKFWEEATPLWITNQRAGHASGAAMWPGTDV- 144

  Fly   139 KVFTHLPTGGAP----LRFETFARSDISDRL-RLDQWTFDKVRNFMTNEQNVQPLRDATSVIFFV 198
            |:....||...|    :.||        ||: ::.:|...|           .|:.     :.|:
  Rat   145 KIHESYPTHYLPYNESVSFE--------DRVAKIIEWFTAK-----------DPIN-----LGFL 185

  Fly   199 YLADIDLAEHVHMPNS-------LNFREKLNYTQRGIRQTYELFESVFNDSRTAYLMTADYGISL 256
            |..:.|...|...|:|       .:...||.|..:.:::. :|:.::      ..::|:|:|:: 
  Rat   186 YWEEPDDTGHDVGPDSPLMGPVISDIDHKLGYLIKMLKKA-KLWNNI------NLIVTSDHGMT- 242

  Fly   257 HGGGGERGVETP--------FILWGAGVKRSAPNPG---QNFTAGENG-PILPLYQLEQI----- 304
             ....||.:|..        .::..:.|....|..|   :.:.|..|. |.|.:|:.|:|     
  Rat   243 -QCSKERVIELDQYLDKEHYTLIDHSPVAAILPKEGKFNEVYDALANAHPNLTVYKKEEIPERWH 306

  Fly   305 -----QLAPLMSA---------------LIGLPPPMNNMALMPLGFL---------------NTS 334
                 ::.|:::.               |:|.....|.:|.|...||               |::
  Rat   307 YKHSDRVQPIVAVADEGWYILQNKSDEFLLGNHGYDNALAEMHPIFLAHGPAFRKNFTKEAMNST 371

  Fly   335 VQYELQVLHL-------------NAMQLLAQARILIKRHEDGILY---LLLPKFESLGSAEIENY 383
            ..|.| |.||             |...||:.|.      ...|.|   ..||    ||||:...|
  Rat   372 DLYSL-VCHLLNVTALPHNGSFRNVQDLLSSAA------PKAIPYTQSTTLP----LGSAKPGEY 425

  Fly   384 PQIIKYLVAKEQYEEALKVSHKIAKLAQECMEYYHGYYHLPLLVATTASYLVWFYLLLVRLARES 448
            .|                         :|...||.| ..|..|:|     :|:|.:|:..|.|..
  Rat   426 EQ-------------------------EESYPYYIG-ISLGSLIA-----IVFFVVLIKHLIRSQ 459

  Fly   449 NH 450
            .|
  Rat   460 MH 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4907NP_651086.1 GPI_EPT_1 42..327 CDD:293744 67/363 (18%)
PigN 413..858 CDD:282796 12/38 (32%)
Enpp5NP_001012762.1 Enpp 28..382 CDD:293742 76/393 (19%)
Phosphodiest 30..342 CDD:279931 65/350 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.