DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4907 and ENPP4

DIOPT Version :9

Sequence 1:NP_651086.1 Gene:CG4907 / 42686 FlyBaseID:FBgn0039010 Length:919 Species:Drosophila melanogaster
Sequence 2:NP_055751.1 Gene:ENPP4 / 22875 HGNCID:3359 Length:453 Species:Homo sapiens


Alignment Length:430 Identity:87/430 - (20%)
Similarity:130/430 - (30%) Gaps:160/430 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVVHLLLLGSILSIYFQSTILSDLEPLSTLRELGLEPPADRLVVFVVDGLRAQSVLADHCSAVPD 71
            |:|.||..|.|..  |:|...|.|.|              :|::...||.|| ..|.::  ..|.
Human     3 LLVILLFSGLITG--FRSDSSSSLPP--------------KLLLVSFDGFRA-DYLKNY--EFPH 48

  Fly    72 LRELFVEQALVGISRACPPTVTRPGHIAIFGGFNEDPAATLT----------------------W 114
            |:....|..||...:....|.|.|.|.:|..|..|:....:.                      |
Human    49 LQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWW 113

  Fly   115 NPS-----TFDSVFNRSRNAIGWMQAEVA-----------------------KVFTHLPTGGAPL 151
            |.:     |.....|||..|..|...:|.                       .:...|.....|:
Human   114 NEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPV 178

  Fly   152 RF--------------------ETFAR---------SDISDRLR-LDQWTFDKVRNFMTNEQNV- 185
            .|                    |..:|         .|:..||: |..|  :.:...:|::..: 
Human   179 TFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLW--ENLNVIITSDHGMT 241

  Fly   186 ----QPLRDATSVIFFVYLADIDLAEHVHMPNSLNFREKLN-----------YTQRGI--RQTYE 233
                ..|.:..|.|...|...|||:....:...:|..|..|           |.:..|  |..|:
Human   242 QCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQ 306

  Fly   234 LFESVFNDSRTAYLMTADYG--ISLHGGG---GERGVET------PFI-----LWGAGVKRSAPN 282
                 .||.....::.||.|  |.|:...   |:.|.:.      ||:     .:..|.|.|..|
Human   307 -----HNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTIN 366

  Fly   283 PGQNFTAGENGPILPLYQLEQIQLAPLMSALIGLPPPMNN 322
                        |:.:|        |:|..::||.|..||
Human   367 ------------IVDIY--------PMMCHILGLKPHPNN 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4907NP_651086.1 GPI_EPT_1 42..327 CDD:293744 76/395 (19%)
PigN 413..858 CDD:282796
ENPP4NP_055751.1 Enpp 26..379 CDD:293742 72/396 (18%)
Phosphodiest 28..339 CDD:279931 61/320 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.