DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4907 and Enpp3

DIOPT Version :9

Sequence 1:NP_651086.1 Gene:CG4907 / 42686 FlyBaseID:FBgn0039010 Length:919 Species:Drosophila melanogaster
Sequence 2:NP_598766.2 Gene:Enpp3 / 209558 MGIID:2143702 Length:874 Species:Mus musculus


Alignment Length:621 Identity:113/621 - (18%)
Similarity:184/621 - (29%) Gaps:253/621 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PPADRLVVFVVDGLRAQSVLADHCSAVPDLRELFVEQALVGI----SRACPPTVTRPGHIAIFGG 103
            ||   :::|.:||.||: .|....:.:|::.:|    ...||    .||..||.|.|.|..|..|
Mouse   159 PP---VILFSMDGFRAE-YLQTWSTLLPNINKL----KTCGIHSKYMRAMYPTKTFPNHYTIVTG 215

  Fly   104 FNEDPAATLTWNPSTFDSVFNRS--------RNAIGW---------MQAEVAKVFTHLP------ 145
            ...:....:..|  .:|...|::        .|...|         |...:.....:.|      
Mouse   216 LYPESHGIIDNN--MYDVHLNKNFSLSSVEKSNPAWWSGQPIWLTAMYQGLKAACYYWPGSDVAV 278

  Fly   146 TGGAPLRFETFARSDISDR--LRLDQWTFDKVRNFMTNEQNVQPLRDATSVIFFVYLADIDLAEH 208
            .|..|..:..::.|...:|  ..|.|| .|            .|..|..| .:.:|:.:.|.|.|
Mouse   279 NGSFPTIYRNYSNSVPYERRITTLLQW-LD------------LPKADRPS-FYTIYVEEPDSAGH 329

  Fly   209 VHMP-----------------------------NSLN----------------------FREKLN 222
            ...|                             |.:|                      :..|:|
Mouse   330 SSGPVSAGVIKALQSVDNAFGMLMEGLKQRNLHNCVNIIVLADHGMDQTSCDRVEYMTDYFPKIN 394

  Fly   223 Y----------TQRGIRQTYELFES---VFN------DSRTAYLMTADYGISLHGGGGERGVETP 268
            :          ..|.|.|.:..|.|   |.|      |......:|.|....||.....| ::..
Mouse   395 FYMYQGPAPRIRTRNIPQDFFTFNSEEIVRNLSCRKPDQHFKPYLTPDLPKRLHYAKNVR-IDKA 458

  Fly   269 FIL----WGAGVKRSAPNPGQNFTAGEN-------------GP-------ILPLYQLEQIQLAPL 309
            .::    |.|...:.:.|.|.. |.|.|             ||       |.|   .|.|::..|
Mouse   459 HLMVDRQWLAFRSKGSSNCGGG-THGYNNEFKSMEAIFLAHGPSFIEKTVIEP---FENIEVYNL 519

  Fly   310 MSALIGLPPPMNNMA------LMPLGFLNTSVQYEL----------------------------- 339
            :..|:.:.|..||..      |:...|...|...||                             
Mouse   520 LCDLLHIEPAPNNGTHGSLNHLLKTPFYKPSHAGELSTPADCGFTTPLPTDPLDCSCPALQNTPG 584

  Fly   340 ------QVLHLNAMQLLA---------QARILIKRHEDGILY-----------LLLPKFES---L 375
                  |.|:|:..::.|         :.|::.|..:..:||           :.:|.:.|   |
Mouse   585 LEEQANQRLNLSEGEVAATVKANLPFGRPRVMQKNGDHCLLYHRDYISGYGKAMKMPMWSSYTVL 649

  Fly   376 GSAEIENYPQIIKYLVAKEQYEEALKVSHKIA-KLAQECMEYY------HGYYHLPLLVATTASY 433
            ...:..:.|..:         .:.|:...::| ..:|:|..|.      ||:.: |.:..|..|.
Mouse   650 KPGDTSSLPPTV---------PDCLRADVRVAPSESQKCSFYLADKNITHGFLY-PAIKGTNESR 704

  Fly   434 L-----------------VWFY---LLLVRLARESN 449
            .                 :|.|   :||::.|.|.|
Mouse   705 YDALITSNLVPMYKEFKKMWDYFHEVLLIKYAIERN 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4907NP_651086.1 GPI_EPT_1 42..327 CDD:293744 80/412 (19%)
PigN 413..858 CDD:282796 14/63 (22%)
Enpp3NP_598766.2 SO 50..93 CDD:197571
Cell attachment site. /evidence=ECO:0000255 78..80
SO 94..137 CDD:197571
Phosphodiesterase 140..509 70/375 (19%)
Enpp 159..525 CDD:293742 76/394 (19%)
Phosphodiest 161..485 CDD:279931 65/346 (19%)
Nuclease 605..874 25/146 (17%)
NUC 627..856 CDD:214683 21/124 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.