DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4907 and F13H10.5

DIOPT Version :9

Sequence 1:NP_651086.1 Gene:CG4907 / 42686 FlyBaseID:FBgn0039010 Length:919 Species:Drosophila melanogaster
Sequence 2:NP_502049.2 Gene:F13H10.5 / 184442 WormBaseID:WBGene00008776 Length:446 Species:Caenorhabditis elegans


Alignment Length:229 Identity:47/229 - (20%)
Similarity:78/229 - (34%) Gaps:77/229 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILSIYFQSTILSDLEPLSTLRELGLEPPADRLVVFVVDGLRAQSVLADHCSAVPDLRELFVEQAL 81
            :|...|.||:.|                 .:|.|.|:|||.|.                      
 Worm    12 LLLFLFSSTVNS-----------------QKLAVVVIDGLAAN---------------------- 37

  Fly    82 VGISRACPPTVTRPGHIAIFGGFNEDPAATLTWNPSTFD-----SVFNRSRNAIGWMQAEVAKVF 141
                     |..:..|:::|..|.|:.    .|:...|.     |:.||.....|.:......:.
 Worm    38 ---------TFYKFSHLSVFRTFEEEG----VWSTKVFPVFPTFSISNRHSLLTGTLPRRHGIIG 89

  Fly   142 THLPTGGAPLRFETF-ARSDISDRLRLDQWTFDKVRNFMTNEQNVQPLRDATSVIFFVYL---AD 202
            .::......|:|:.| |.||.|    .|.|:.|.:        .:..||.:.||..|.:.   .|
 Worm    90 DYINNWKDNLKFQNFTADSDFS----RDWWSIDPI--------YISALRSSASVAMFFFPECDVD 142

  Fly   203 IDLAEHVHMP---NSLNFREKLNYTQRGIRQTYE 233
            .|:|..:.:|   :...|.:: :..:|.|:.|.|
 Worm   143 WDVAPQICVPPRTDGKTFADE-SQAKRVIQATRE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4907NP_651086.1 GPI_EPT_1 42..327 CDD:293744 42/204 (21%)
PigN 413..858 CDD:282796
F13H10.5NP_502049.2 Enpp 24..392 CDD:293742 42/200 (21%)
Phosphodiest 26..335 CDD:279931 42/198 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.